Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P55058

- PLTP_HUMAN

UniProt

P55058 - PLTP_HUMAN

Protein

Phospholipid transfer protein

Gene

PLTP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 141 (01 Oct 2014)
      Sequence version 1 (01 Oct 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Facilitates the transfer of a spectrum of different lipid molecules, including diacylglycerol, phosphatidic acid, sphingomyelin, phosphatidylcholine, phosphatidylglycerol, cerebroside and phosphatidyl ethanolamine. Essential for the transfer of excess surface lipids from triglyceride-rich lipoproteins to HDL, thereby facilitating the formation of smaller lipoprotein remnants, contributing to the formation of LDL, and assisting in the maturation of HDL particles. PLTP also plays a key role in the uptake of cholesterol from peripheral cells and tissues that is subsequently transported to the liver for degradation and excretion. Two distinct forms of PLTP exist in plasma: an active form that can transfer PC from phospholipid vesicles to high-density lipoproteins (HDL), and an inactive form that lacks this capability.

    GO - Molecular functioni

    1. lipid binding Source: InterPro

    GO - Biological processi

    1. lipid metabolic process Source: ProtInc
    2. lipid transport Source: UniProtKB-KW
    3. sperm motility Source: Ensembl
    4. vitamin E biosynthetic process Source: Ensembl

    Keywords - Biological processi

    Lipid transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_13621. HDL-mediated lipid transport.
    SignaLinkiP55058.

    Protein family/group databases

    TCDBi1.C.40.1.4. the bactericidal permeability increasing protein (bpip) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Phospholipid transfer protein
    Alternative name(s):
    Lipid transfer protein II
    Gene namesi
    Name:PLTP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:9093. PLTP.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: ProtInc
    2. extracellular space Source: UniProt

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA273.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 17171 PublicationAdd
    BLAST
    Chaini18 – 493476Phospholipid transfer proteinPRO_0000017162Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi64 – 641N-linked (GlcNAc...) (complex)3 Publications
    Glycosylationi94 – 941N-linked (GlcNAc...)1 Publication
    Glycosylationi117 – 1171N-linked (GlcNAc...) (complex)
    Glycosylationi143 – 1431N-linked (GlcNAc...)2 Publications
    Disulfide bondi146 ↔ 1851 Publication
    Glycosylationi245 – 2451N-linked (GlcNAc...) (complex)2 Publications
    Glycosylationi398 – 3981N-linked (GlcNAc...)1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiP55058.
    PaxDbiP55058.
    PRIDEiP55058.

    PTM databases

    PhosphoSiteiP55058.

    Miscellaneous databases

    PMAP-CutDBP55058.

    Expressioni

    Tissue specificityi

    Wide tissue distribution. Placenta > pancreas > lung > kidney > heart > liver > skeletal muscle > brain.

    Gene expression databases

    ArrayExpressiP55058.
    BgeeiP55058.
    CleanExiHS_PLTP.
    GenevestigatoriP55058.

    Organism-specific databases

    HPAiCAB032873.

    Interactioni

    Protein-protein interaction databases

    BioGridi111374. 3 interactions.
    STRINGi9606.ENSP00000361508.

    Structurei

    3D structure databases

    ProteinModelPortaliP55058.
    SMRiP55058. Positions 20-462.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG290011.
    HOGENOMiHOG000231006.
    HOVERGENiHBG103156.
    InParanoidiP55058.
    KOiK08761.
    OrthoDBiEOG76739B.
    PhylomeDBiP55058.
    TreeFamiTF315617.

    Family and domain databases

    InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
    IPR001124. Lipid-bd_serum_glycop_C.
    IPR017954. Lipid-bd_serum_glycop_CS.
    IPR017942. Lipid-bd_serum_glycop_N.
    [Graphical view]
    PfamiPF01273. LBP_BPI_CETP. 1 hit.
    PF02886. LBP_BPI_CETP_C. 1 hit.
    [Graphical view]
    SMARTiSM00328. BPI1. 1 hit.
    SM00329. BPI2. 1 hit.
    [Graphical view]
    SUPFAMiSSF55394. SSF55394. 2 hits.
    PROSITEiPS00400. LBP_BPI_CETP. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P55058-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MALFGALFLA LLAGAHAEFP GCKIRVTSKA LELVKQEGLR FLEQELETIT    50
    IPDLRGKEGH FYYNISEVKV TELQLTSSEL DFQPQQELML QITNASLGLR 100
    FRRQLLYWFF YDGGYINASA EGVSIRTGLE LSRDPAGRMK VSNVSCQASV 150
    SRMHAAFGGT FKKVYDFLST FITSGMRFLL NQQICPVLYH AGTVLLNSLL 200
    DTVPVRSSVD ELVGIDYSLM KDPVASTSNL DMDFRGAFFP LTERNWSLPN 250
    RAVEPQLQEE ERMVYVAFSE FFFDSAMESY FRAGALQLLL VGDKVPHDLD 300
    MLLRATYFGS IVLLSPAVID SPLKLELRVL APPRCTIKPS GTTISVTASV 350
    TIALVPPDQP EVQLSSMTMD ARLSAKMALR GKALRTQLDL RRFRIYSNHS 400
    ALESLALIPL QAPLKTMLQI GVMPMLNERT WRGVQIPLPE GINFVHEVVT 450
    NHAGFLTIGA DLHFAKGLRE VIEKNRPADV RASTAPTPST AAV 493
    Length:493
    Mass (Da):54,739
    Last modified:October 1, 1996 - v1
    Checksum:iC6E4852F18E12317
    GO
    Isoform 2 (identifier: P55058-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         110-162: FYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFK → L

    Show »
    Length:441
    Mass (Da):49,272
    Checksum:i4D7435F89F79ABAA
    GO
    Isoform 3 (identifier: P55058-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         68-162: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:398
    Mass (Da):44,135
    Checksum:i6D2141C6899E98CB
    GO
    Isoform 4 (identifier: P55058-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-88: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:405
    Mass (Da):44,847
    Checksum:iB916DC8F704401C0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti18 – 181E → V in AAH19847. (PubMed:15489334)Curated
    Sequence conflicti18 – 181E → V in AAH19898. (PubMed:15489334)Curated
    Sequence conflicti331 – 3311A → V in BAG61226. (PubMed:14702039)Curated
    Sequence conflicti375 – 3751A → S in BAG56696. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti124 – 1241S → Y.1 Publication
    Corresponds to variant rs11569636 [ dbSNP | Ensembl ].
    VAR_018879
    Natural varianti282 – 2821R → Q.1 Publication
    VAR_017020
    Natural varianti372 – 3721R → H.1 Publication
    VAR_017021
    Natural varianti380 – 3801R → W.1 Publication
    Corresponds to variant rs6065903 [ dbSNP | Ensembl ].
    VAR_017022
    Natural varianti425 – 4251M → I.1 Publication
    Corresponds to variant rs11569675 [ dbSNP | Ensembl ].
    VAR_018880
    Natural varianti444 – 4441F → L.
    Corresponds to variant rs1804161 [ dbSNP | Ensembl ].
    VAR_012073
    Natural varianti487 – 4871T → K.
    Corresponds to variant rs1056929 [ dbSNP | Ensembl ].
    VAR_012074

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8888Missing in isoform 4. 1 PublicationVSP_054028Add
    BLAST
    Alternative sequencei68 – 16295Missing in isoform 3. 1 PublicationVSP_045877Add
    BLAST
    Alternative sequencei110 – 16253FYDGG…GGTFK → L in isoform 2. 2 PublicationsVSP_003050Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L26232 mRNA. Translation: AAA36443.1.
    AB076694 mRNA. Translation: BAB79630.1.
    AL008726 Genomic DNA. Translation: CAA15499.1.
    AK289371 mRNA. Translation: BAF82060.1.
    AK293150 mRNA. Translation: BAG56696.1.
    AK299181 mRNA. Translation: BAG61226.1.
    AL008726 Genomic DNA. Translation: CAC36020.1.
    AY509570 Genomic DNA. Translation: AAR87775.1.
    CH471077 Genomic DNA. Translation: EAW75782.1.
    CH471077 Genomic DNA. Translation: EAW75781.1.
    CH471077 Genomic DNA. Translation: EAW75783.1.
    CH471077 Genomic DNA. Translation: EAW75785.1.
    CH471077 Genomic DNA. Translation: EAW75787.1.
    BC005045 mRNA. Translation: AAH05045.1.
    BC019847 mRNA. Translation: AAH19847.1.
    BC019898 mRNA. Translation: AAH19898.1.
    CCDSiCCDS13386.1. [P55058-1]
    CCDS13387.1. [P55058-2]
    CCDS56196.1. [P55058-4]
    CCDS56197.1. [P55058-3]
    PIRiA53533.
    RefSeqiNP_001229849.1. NM_001242920.1. [P55058-3]
    NP_001229850.1. NM_001242921.1. [P55058-4]
    NP_006218.1. NM_006227.3. [P55058-1]
    NP_872617.1. NM_182676.2. [P55058-2]
    UniGeneiHs.439312.

    Genome annotation databases

    EnsembliENST00000354050; ENSP00000335290; ENSG00000100979. [P55058-2]
    ENST00000372420; ENSP00000361497; ENSG00000100979. [P55058-4]
    ENST00000372431; ENSP00000361508; ENSG00000100979. [P55058-1]
    ENST00000420868; ENSP00000411671; ENSG00000100979. [P55058-3]
    ENST00000477313; ENSP00000417138; ENSG00000100979. [P55058-1]
    GeneIDi5360.
    KEGGihsa:5360.
    UCSCiuc002xql.2. human. [P55058-1]
    uc002xqo.2. human. [P55058-2]

    Polymorphism databases

    DMDMi1709662.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    SeattleSNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L26232 mRNA. Translation: AAA36443.1 .
    AB076694 mRNA. Translation: BAB79630.1 .
    AL008726 Genomic DNA. Translation: CAA15499.1 .
    AK289371 mRNA. Translation: BAF82060.1 .
    AK293150 mRNA. Translation: BAG56696.1 .
    AK299181 mRNA. Translation: BAG61226.1 .
    AL008726 Genomic DNA. Translation: CAC36020.1 .
    AY509570 Genomic DNA. Translation: AAR87775.1 .
    CH471077 Genomic DNA. Translation: EAW75782.1 .
    CH471077 Genomic DNA. Translation: EAW75781.1 .
    CH471077 Genomic DNA. Translation: EAW75783.1 .
    CH471077 Genomic DNA. Translation: EAW75785.1 .
    CH471077 Genomic DNA. Translation: EAW75787.1 .
    BC005045 mRNA. Translation: AAH05045.1 .
    BC019847 mRNA. Translation: AAH19847.1 .
    BC019898 mRNA. Translation: AAH19898.1 .
    CCDSi CCDS13386.1. [P55058-1 ]
    CCDS13387.1. [P55058-2 ]
    CCDS56196.1. [P55058-4 ]
    CCDS56197.1. [P55058-3 ]
    PIRi A53533.
    RefSeqi NP_001229849.1. NM_001242920.1. [P55058-3 ]
    NP_001229850.1. NM_001242921.1. [P55058-4 ]
    NP_006218.1. NM_006227.3. [P55058-1 ]
    NP_872617.1. NM_182676.2. [P55058-2 ]
    UniGenei Hs.439312.

    3D structure databases

    ProteinModelPortali P55058.
    SMRi P55058. Positions 20-462.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111374. 3 interactions.
    STRINGi 9606.ENSP00000361508.

    Chemistry

    BindingDBi P55058.
    ChEMBLi CHEMBL5962.

    Protein family/group databases

    TCDBi 1.C.40.1.4. the bactericidal permeability increasing protein (bpip) family.

    PTM databases

    PhosphoSitei P55058.

    Polymorphism databases

    DMDMi 1709662.

    Proteomic databases

    MaxQBi P55058.
    PaxDbi P55058.
    PRIDEi P55058.

    Protocols and materials databases

    DNASUi 5360.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000354050 ; ENSP00000335290 ; ENSG00000100979 . [P55058-2 ]
    ENST00000372420 ; ENSP00000361497 ; ENSG00000100979 . [P55058-4 ]
    ENST00000372431 ; ENSP00000361508 ; ENSG00000100979 . [P55058-1 ]
    ENST00000420868 ; ENSP00000411671 ; ENSG00000100979 . [P55058-3 ]
    ENST00000477313 ; ENSP00000417138 ; ENSG00000100979 . [P55058-1 ]
    GeneIDi 5360.
    KEGGi hsa:5360.
    UCSCi uc002xql.2. human. [P55058-1 ]
    uc002xqo.2. human. [P55058-2 ]

    Organism-specific databases

    CTDi 5360.
    GeneCardsi GC20M044528.
    HGNCi HGNC:9093. PLTP.
    HPAi CAB032873.
    MIMi 172425. gene.
    neXtProti NX_P55058.
    PharmGKBi PA273.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG290011.
    HOGENOMi HOG000231006.
    HOVERGENi HBG103156.
    InParanoidi P55058.
    KOi K08761.
    OrthoDBi EOG76739B.
    PhylomeDBi P55058.
    TreeFami TF315617.

    Enzyme and pathway databases

    Reactomei REACT_13621. HDL-mediated lipid transport.
    SignaLinki P55058.

    Miscellaneous databases

    GeneWikii Phospholipid_transfer_protein.
    GenomeRNAii 5360.
    NextBioi 20778.
    PMAP-CutDB P55058.
    PROi P55058.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P55058.
    Bgeei P55058.
    CleanExi HS_PLTP.
    Genevestigatori P55058.

    Family and domain databases

    InterProi IPR017943. Bactericidal_perm-incr_a/b_dom.
    IPR001124. Lipid-bd_serum_glycop_C.
    IPR017954. Lipid-bd_serum_glycop_CS.
    IPR017942. Lipid-bd_serum_glycop_N.
    [Graphical view ]
    Pfami PF01273. LBP_BPI_CETP. 1 hit.
    PF02886. LBP_BPI_CETP_C. 1 hit.
    [Graphical view ]
    SMARTi SM00328. BPI1. 1 hit.
    SM00329. BPI2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55394. SSF55394. 2 hits.
    PROSITEi PS00400. LBP_BPI_CETP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete cDNA encoding human phospholipid transfer protein from human endothelial cells."
      Day J.R., Albers J.J., Lofton-Day C.E., Gilbert T.L., Ching A.F.T., Grant F.J., O'Hara P.J., Marcovina S.M., Adolphson J.L.
      J. Biol. Chem. 269:9388-9391(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 18-27 AND 163-184.
      Tissue: Umbilical vein endothelial cell.
    2. "Molecular cloning and functional characterization of phospholipid transfer protein from human placenta cDNA library."
      Kobayashi Y., Ohshiro N., Shibusawa A., Sasaki T., Tokuyama S., Yamamoto T.
      Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Placenta.
    3. SeattleSNPs variation discovery resource
      Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM1 1), VARIANTS TYR-124 AND ILE-425.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
      Tissue: Adipose tissue.
    5. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Placenta.
    8. "Role of cysteine residues in human plasma phospholipid transfer protein."
      Qu S.J., Fan H.Z., Kilinc C., Pownall H.J.
      J. Protein Chem. 18:193-198(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISULFIDE BOND.
    9. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
      Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
      J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-64; ASN-94; ASN-143; ASN-245 AND ASN-398.
      Tissue: Plasma.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-64.
      Tissue: Liver.
    12. Cited for: GLYCOSYLATION AT ASN-64; ASN-143 AND ASN-245.
    13. "Role of plasma phospholipid transfer protein in lipid and lipoprotein metabolism."
      Albers J.J., Vuletic S., Cheung M.C.
      Biochim. Biophys. Acta 1821:345-357(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW ON FUNCTION.
    14. "Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors."
      Morabia A., Cayanis E., Costanza M.C., Ross B.M., Flaherty M.S., Alvin G.B., Das K., Gilliam T.C.
      Hum. Mol. Genet. 12:2733-2743(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS GLN-282; HIS-372 AND TRP-380.

    Entry informationi

    Entry nameiPLTP_HUMAN
    AccessioniPrimary (citable) accession number: P55058
    Secondary accession number(s): A8K006
    , B4DDD5, B4DRB4, E1P5N8, E7EV16, Q8WTT1, Q9BR07, Q9BSH8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: October 1, 1996
    Last modified: October 1, 2014
    This is version 141 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3