Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipid transfer protein

Gene

PLTP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Facilitates the transfer of a spectrum of different lipid molecules, including diacylglycerol, phosphatidic acid, sphingomyelin, phosphatidylcholine, phosphatidylglycerol, cerebroside and phosphatidyl ethanolamine. Essential for the transfer of excess surface lipids from triglyceride-rich lipoproteins to HDL, thereby facilitating the formation of smaller lipoprotein remnants, contributing to the formation of LDL, and assisting in the maturation of HDL particles. PLTP also plays a key role in the uptake of cholesterol from peripheral cells and tissues that is subsequently transported to the liver for degradation and excretion. Two distinct forms of PLTP exist in plasma: an active form that can transfer PC from phospholipid vesicles to high-density lipoproteins (HDL), and an inactive form that lacks this capability.

GO - Molecular functioni

GO - Biological processi

  • high-density lipoprotein particle remodeling Source: AgBase
  • lipid metabolic process Source: ProtInc
  • lipid transport Source: UniProtKB-KW
  • positive regulation of cholesterol efflux Source: AgBase
  • sperm motility Source: Ensembl
  • vitamin E biosynthetic process Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Enzyme and pathway databases

ReactomeiREACT_13621. HDL-mediated lipid transport.
SignaLinkiP55058.

Protein family/group databases

TCDBi1.C.40.1.4. the bactericidal permeability increasing protein (bpip) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Phospholipid transfer protein
Alternative name(s):
Lipid transfer protein II
Gene namesi
Name:PLTP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:9093. PLTP.

Subcellular locationi

GO - Cellular componenti

  • extracellular region Source: ProtInc
  • extracellular space Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA273.

Polymorphism and mutation databases

BioMutaiPLTP.
DMDMi1709662.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 17171 PublicationAdd
BLAST
Chaini18 – 493476Phospholipid transfer proteinPRO_0000017162Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi64 – 641N-linked (GlcNAc...) (complex)3 Publications
Glycosylationi94 – 941N-linked (GlcNAc...)1 Publication
Glycosylationi117 – 1171N-linked (GlcNAc...) (complex)
Glycosylationi143 – 1431N-linked (GlcNAc...)2 Publications
Disulfide bondi146 ↔ 1851 Publication
Glycosylationi245 – 2451N-linked (GlcNAc...) (complex)2 Publications
Glycosylationi398 – 3981N-linked (GlcNAc...)1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP55058.
PaxDbiP55058.
PRIDEiP55058.

PTM databases

PhosphoSiteiP55058.

Miscellaneous databases

PMAP-CutDBP55058.

Expressioni

Tissue specificityi

Wide tissue distribution. Placenta > pancreas > lung > kidney > heart > liver > skeletal muscle > brain.

Gene expression databases

BgeeiP55058.
CleanExiHS_PLTP.
GenevisibleiP55058. HS.

Organism-specific databases

HPAiCAB032873.
HPA047207.

Interactioni

Protein-protein interaction databases

BioGridi111374. 26 interactions.
STRINGi9606.ENSP00000361508.

Structurei

3D structure databases

ProteinModelPortaliP55058.
SMRiP55058. Positions 20-462.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG290011.
GeneTreeiENSGT00730000110583.
HOGENOMiHOG000231006.
HOVERGENiHBG103156.
InParanoidiP55058.
KOiK08761.
OMAiAFSEFFF.
OrthoDBiEOG76739B.
PhylomeDBiP55058.
TreeFamiTF315617.

Family and domain databases

InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
IPR030675. BPI/LBP.
IPR001124. Lipid-bd_serum_glycop_C.
IPR017954. Lipid-bd_serum_glycop_CS.
IPR017942. Lipid-bd_serum_glycop_N.
IPR030179. PLTP.
[Graphical view]
PANTHERiPTHR10504:SF16. PTHR10504:SF16. 1 hit.
PfamiPF01273. LBP_BPI_CETP. 1 hit.
PF02886. LBP_BPI_CETP_C. 1 hit.
[Graphical view]
PIRSFiPIRSF002417. Lipid_binding_protein. 1 hit.
SMARTiSM00328. BPI1. 1 hit.
SM00329. BPI2. 1 hit.
[Graphical view]
SUPFAMiSSF55394. SSF55394. 2 hits.
PROSITEiPS00400. LBP_BPI_CETP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P55058-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALFGALFLA LLAGAHAEFP GCKIRVTSKA LELVKQEGLR FLEQELETIT
60 70 80 90 100
IPDLRGKEGH FYYNISEVKV TELQLTSSEL DFQPQQELML QITNASLGLR
110 120 130 140 150
FRRQLLYWFF YDGGYINASA EGVSIRTGLE LSRDPAGRMK VSNVSCQASV
160 170 180 190 200
SRMHAAFGGT FKKVYDFLST FITSGMRFLL NQQICPVLYH AGTVLLNSLL
210 220 230 240 250
DTVPVRSSVD ELVGIDYSLM KDPVASTSNL DMDFRGAFFP LTERNWSLPN
260 270 280 290 300
RAVEPQLQEE ERMVYVAFSE FFFDSAMESY FRAGALQLLL VGDKVPHDLD
310 320 330 340 350
MLLRATYFGS IVLLSPAVID SPLKLELRVL APPRCTIKPS GTTISVTASV
360 370 380 390 400
TIALVPPDQP EVQLSSMTMD ARLSAKMALR GKALRTQLDL RRFRIYSNHS
410 420 430 440 450
ALESLALIPL QAPLKTMLQI GVMPMLNERT WRGVQIPLPE GINFVHEVVT
460 470 480 490
NHAGFLTIGA DLHFAKGLRE VIEKNRPADV RASTAPTPST AAV
Length:493
Mass (Da):54,739
Last modified:October 1, 1996 - v1
Checksum:iC6E4852F18E12317
GO
Isoform 2 (identifier: P55058-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-162: FYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFK → L

Show »
Length:441
Mass (Da):49,272
Checksum:i4D7435F89F79ABAA
GO
Isoform 3 (identifier: P55058-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-162: Missing.

Note: No experimental confirmation available.
Show »
Length:398
Mass (Da):44,135
Checksum:i6D2141C6899E98CB
GO
Isoform 4 (identifier: P55058-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-88: Missing.

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):44,847
Checksum:iB916DC8F704401C0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti18 – 181E → V in AAH19847 (PubMed:15489334).Curated
Sequence conflicti18 – 181E → V in AAH19898 (PubMed:15489334).Curated
Sequence conflicti331 – 3311A → V in BAG61226 (PubMed:14702039).Curated
Sequence conflicti375 – 3751A → S in BAG56696 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti124 – 1241S → Y.1 Publication
Corresponds to variant rs11569636 [ dbSNP | Ensembl ].
VAR_018879
Natural varianti282 – 2821R → Q.1 Publication
VAR_017020
Natural varianti372 – 3721R → H.1 Publication
VAR_017021
Natural varianti380 – 3801R → W.1 Publication
Corresponds to variant rs6065903 [ dbSNP | Ensembl ].
VAR_017022
Natural varianti425 – 4251M → I.1 Publication
Corresponds to variant rs11569675 [ dbSNP | Ensembl ].
VAR_018880
Natural varianti444 – 4441F → L.
Corresponds to variant rs1804161 [ dbSNP | Ensembl ].
VAR_012073
Natural varianti487 – 4871T → K.
Corresponds to variant rs1056929 [ dbSNP | Ensembl ].
VAR_012074

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8888Missing in isoform 4. 1 PublicationVSP_054028Add
BLAST
Alternative sequencei68 – 16295Missing in isoform 3. 1 PublicationVSP_045877Add
BLAST
Alternative sequencei110 – 16253FYDGG…GGTFK → L in isoform 2. 2 PublicationsVSP_003050Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L26232 mRNA. Translation: AAA36443.1.
AB076694 mRNA. Translation: BAB79630.1.
AL008726 Genomic DNA. Translation: CAA15499.1.
AK289371 mRNA. Translation: BAF82060.1.
AK293150 mRNA. Translation: BAG56696.1.
AK299181 mRNA. Translation: BAG61226.1.
AL008726 Genomic DNA. Translation: CAC36020.1.
AY509570 Genomic DNA. Translation: AAR87775.1.
CH471077 Genomic DNA. Translation: EAW75782.1.
CH471077 Genomic DNA. Translation: EAW75781.1.
CH471077 Genomic DNA. Translation: EAW75783.1.
CH471077 Genomic DNA. Translation: EAW75785.1.
CH471077 Genomic DNA. Translation: EAW75787.1.
BC005045 mRNA. Translation: AAH05045.1.
BC019847 mRNA. Translation: AAH19847.1.
BC019898 mRNA. Translation: AAH19898.1.
CCDSiCCDS13386.1. [P55058-1]
CCDS13387.1. [P55058-2]
CCDS56196.1. [P55058-4]
CCDS56197.1. [P55058-3]
PIRiA53533.
RefSeqiNP_001229849.1. NM_001242920.1. [P55058-3]
NP_001229850.1. NM_001242921.1. [P55058-4]
NP_006218.1. NM_006227.3. [P55058-1]
NP_872617.1. NM_182676.2. [P55058-2]
UniGeneiHs.439312.

Genome annotation databases

EnsembliENST00000354050; ENSP00000335290; ENSG00000100979. [P55058-2]
ENST00000372420; ENSP00000361497; ENSG00000100979. [P55058-4]
ENST00000372431; ENSP00000361508; ENSG00000100979.
ENST00000420868; ENSP00000411671; ENSG00000100979. [P55058-3]
ENST00000477313; ENSP00000417138; ENSG00000100979.
GeneIDi5360.
KEGGihsa:5360.
UCSCiuc002xql.2. human. [P55058-1]
uc002xqo.2. human. [P55058-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L26232 mRNA. Translation: AAA36443.1.
AB076694 mRNA. Translation: BAB79630.1.
AL008726 Genomic DNA. Translation: CAA15499.1.
AK289371 mRNA. Translation: BAF82060.1.
AK293150 mRNA. Translation: BAG56696.1.
AK299181 mRNA. Translation: BAG61226.1.
AL008726 Genomic DNA. Translation: CAC36020.1.
AY509570 Genomic DNA. Translation: AAR87775.1.
CH471077 Genomic DNA. Translation: EAW75782.1.
CH471077 Genomic DNA. Translation: EAW75781.1.
CH471077 Genomic DNA. Translation: EAW75783.1.
CH471077 Genomic DNA. Translation: EAW75785.1.
CH471077 Genomic DNA. Translation: EAW75787.1.
BC005045 mRNA. Translation: AAH05045.1.
BC019847 mRNA. Translation: AAH19847.1.
BC019898 mRNA. Translation: AAH19898.1.
CCDSiCCDS13386.1. [P55058-1]
CCDS13387.1. [P55058-2]
CCDS56196.1. [P55058-4]
CCDS56197.1. [P55058-3]
PIRiA53533.
RefSeqiNP_001229849.1. NM_001242920.1. [P55058-3]
NP_001229850.1. NM_001242921.1. [P55058-4]
NP_006218.1. NM_006227.3. [P55058-1]
NP_872617.1. NM_182676.2. [P55058-2]
UniGeneiHs.439312.

3D structure databases

ProteinModelPortaliP55058.
SMRiP55058. Positions 20-462.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111374. 26 interactions.
STRINGi9606.ENSP00000361508.

Chemistry

BindingDBiP55058.
ChEMBLiCHEMBL5962.

Protein family/group databases

TCDBi1.C.40.1.4. the bactericidal permeability increasing protein (bpip) family.

PTM databases

PhosphoSiteiP55058.

Polymorphism and mutation databases

BioMutaiPLTP.
DMDMi1709662.

Proteomic databases

MaxQBiP55058.
PaxDbiP55058.
PRIDEiP55058.

Protocols and materials databases

DNASUi5360.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354050; ENSP00000335290; ENSG00000100979. [P55058-2]
ENST00000372420; ENSP00000361497; ENSG00000100979. [P55058-4]
ENST00000372431; ENSP00000361508; ENSG00000100979.
ENST00000420868; ENSP00000411671; ENSG00000100979. [P55058-3]
ENST00000477313; ENSP00000417138; ENSG00000100979.
GeneIDi5360.
KEGGihsa:5360.
UCSCiuc002xql.2. human. [P55058-1]
uc002xqo.2. human. [P55058-2]

Organism-specific databases

CTDi5360.
GeneCardsiGC20M044528.
HGNCiHGNC:9093. PLTP.
HPAiCAB032873.
HPA047207.
MIMi172425. gene.
neXtProtiNX_P55058.
PharmGKBiPA273.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG290011.
GeneTreeiENSGT00730000110583.
HOGENOMiHOG000231006.
HOVERGENiHBG103156.
InParanoidiP55058.
KOiK08761.
OMAiAFSEFFF.
OrthoDBiEOG76739B.
PhylomeDBiP55058.
TreeFamiTF315617.

Enzyme and pathway databases

ReactomeiREACT_13621. HDL-mediated lipid transport.
SignaLinkiP55058.

Miscellaneous databases

GeneWikiiPhospholipid_transfer_protein.
GenomeRNAii5360.
NextBioi20778.
PMAP-CutDBP55058.
PROiP55058.
SOURCEiSearch...

Gene expression databases

BgeeiP55058.
CleanExiHS_PLTP.
GenevisibleiP55058. HS.

Family and domain databases

InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
IPR030675. BPI/LBP.
IPR001124. Lipid-bd_serum_glycop_C.
IPR017954. Lipid-bd_serum_glycop_CS.
IPR017942. Lipid-bd_serum_glycop_N.
IPR030179. PLTP.
[Graphical view]
PANTHERiPTHR10504:SF16. PTHR10504:SF16. 1 hit.
PfamiPF01273. LBP_BPI_CETP. 1 hit.
PF02886. LBP_BPI_CETP_C. 1 hit.
[Graphical view]
PIRSFiPIRSF002417. Lipid_binding_protein. 1 hit.
SMARTiSM00328. BPI1. 1 hit.
SM00329. BPI2. 1 hit.
[Graphical view]
SUPFAMiSSF55394. SSF55394. 2 hits.
PROSITEiPS00400. LBP_BPI_CETP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete cDNA encoding human phospholipid transfer protein from human endothelial cells."
    Day J.R., Albers J.J., Lofton-Day C.E., Gilbert T.L., Ching A.F.T., Grant F.J., O'Hara P.J., Marcovina S.M., Adolphson J.L.
    J. Biol. Chem. 269:9388-9391(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 18-27 AND 163-184.
    Tissue: Umbilical vein endothelial cell.
  2. "Molecular cloning and functional characterization of phospholipid transfer protein from human placenta cDNA library."
    Kobayashi Y., Ohshiro N., Shibusawa A., Sasaki T., Tokuyama S., Yamamoto T.
    Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Placenta.
  3. SeattleSNPs variation discovery resource
    Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM1 1), VARIANTS TYR-124 AND ILE-425.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4).
    Tissue: Adipose tissue.
  5. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Placenta.
  8. "Role of cysteine residues in human plasma phospholipid transfer protein."
    Qu S.J., Fan H.Z., Kilinc C., Pownall H.J.
    J. Protein Chem. 18:193-198(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISULFIDE BOND.
  9. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-64; ASN-94; ASN-143; ASN-245 AND ASN-398.
    Tissue: Plasma.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-64.
    Tissue: Liver.
  12. Cited for: GLYCOSYLATION AT ASN-64; ASN-143 AND ASN-245.
  13. "Role of plasma phospholipid transfer protein in lipid and lipoprotein metabolism."
    Albers J.J., Vuletic S., Cheung M.C.
    Biochim. Biophys. Acta 1821:345-357(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW ON FUNCTION.
  14. "Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors."
    Morabia A., Cayanis E., Costanza M.C., Ross B.M., Flaherty M.S., Alvin G.B., Das K., Gilliam T.C.
    Hum. Mol. Genet. 12:2733-2743(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS GLN-282; HIS-372 AND TRP-380.

Entry informationi

Entry nameiPLTP_HUMAN
AccessioniPrimary (citable) accession number: P55058
Secondary accession number(s): A8K006
, B4DDD5, B4DRB4, E1P5N8, E7EV16, Q8WTT1, Q9BR07, Q9BSH8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: July 22, 2015
This is version 149 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.