P55058 (PLTP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phospholipid transfer protein Alternative name(s): Lipid transfer protein II | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 493 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Converts HDL into larger and smaller particles. May play a key role in extracellular phospholipid transport and modulation of hdl particles. |
| Subcellular location | |
| Tissue specificity | Wide tissue distribution. Placenta > pancreas > lung > kidney > heart > liver > skeletal muscle > brain. |
| Sequence similarities | Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid transport Transport |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cellular lipid metabolic process Traceable author statement. Source: Reactome lipid transportInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | extracellular region Traceable author statement. Source: Reactome |
| Molecular function | lipid binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P55058-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P55058-2) The sequence of this isoform differs from the canonical sequence as follows: 110-162: FYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFK → L |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 17 | 17 | Ref.1 | ||||||||
| Chain | 18 – 493 | 476 | Phospholipid transfer protein | PRO_0000017162 | |||||||
Amino acid modifications | |||||||||||
| Modified residue | 93 | 1 | Phosphothreonine Ref.10 | ||||||||
| Modified residue | 96 | 1 | Phosphoserine Ref.10 | ||||||||
| Glycosylation | 64 | 1 | N-linked (GlcNAc...) Ref.9 Ref.11 | ||||||||
| Glycosylation | 94 | 1 | N-linked (GlcNAc...) Ref.9 | ||||||||
| Glycosylation | 117 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 143 | 1 | N-linked (GlcNAc...) Ref.9 | ||||||||
| Glycosylation | 245 | 1 | N-linked (GlcNAc...) Ref.9 | ||||||||
| Glycosylation | 398 | 1 | N-linked (GlcNAc...) Ref.9 | ||||||||
| Disulfide bond | 146 ↔ 185 | Ref.8 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 110 – 162 | 53 | FYDGG…GGTFK → L in isoform 2. | VSP_003050 | |||||||
| Natural variant | 124 | 1 | S → Y. Ref.3 Corresponds to variant rs11569636 [ dbSNP | Ensembl ]. | VAR_018879 | |||||||
| Natural variant | 282 | 1 | R → Q. Ref.12 | VAR_017020 | |||||||
| Natural variant | 372 | 1 | R → H. Ref.12 | VAR_017021 | |||||||
| Natural variant | 380 | 1 | R → W. Ref.12 Corresponds to variant rs6065903 [ dbSNP | Ensembl ]. | VAR_017022 | |||||||
| Natural variant | 425 | 1 | M → I. Ref.3 Corresponds to variant rs11569675 [ dbSNP | Ensembl ]. | VAR_018880 | |||||||
| Natural variant | 444 | 1 | F → L. Corresponds to variant rs1804161 [ dbSNP | Ensembl ]. | VAR_012073 | |||||||
| Natural variant | 487 | 1 | T → K. Corresponds to variant rs1056929 [ dbSNP | Ensembl ]. | VAR_012074 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 18 | 1 | E → V in AAH19847. Ref.7 | ||||||||
| Sequence conflict | 18 | 1 | E → V in AAH19898. Ref.7 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete cDNA encoding human phospholipid transfer protein from human endothelial cells." Day J.R., Albers J.J., Lofton-Day C.E., Gilbert T.L., Ching A.F.T., Grant F.J., O'Hara P.J., Marcovina S.M., Adolphson J.L. J. Biol. Chem. 269:9388-9391(1994) [PubMed: 8132678] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 18-27 AND 163-184. Tissue: Umbilical vein endothelial cell. |
| [2] | "Molecular cloning and functional characterization of phospholipid transfer protein from human placenta cDNA library." Kobayashi Y., Ohshiro N., Shibusawa A., Sasaki T., Tokuyama S., Yamamoto T. Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Placenta. |
| [3] | SeattleSNPs variation discovery resource Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS TYR-124 AND ILE-425. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Adipose tissue. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Placenta. |
| [8] | "Role of cysteine residues in human plasma phospholipid transfer protein." Qu S.J., Fan H.Z., Kilinc C., Pownall H.J. J. Protein Chem. 18:193-198(1999) [PubMed: 10333293] [Abstract] Cited for: DISULFIDE BOND. |
| [9] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-64; ASN-94; ASN-143; ASN-245 AND ASN-398, MASS SPECTROMETRY. Tissue: Plasma. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-93 AND SER-96, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-64, MASS SPECTROMETRY. Tissue: Liver. |
| [12] | "Association of extreme blood lipid profile phenotypic variation with 11 reverse cholesterol transport genes and 10 non-genetic cardiovascular disease risk factors." Morabia A., Cayanis E., Costanza M.C., Ross B.M., Flaherty M.S., Alvin G.B., Das K., Gilliam T.C. Hum. Mol. Genet. 12:2733-2743(2003) [PubMed: 12966036] [Abstract] Cited for: VARIANTS GLN-282; HIS-372 AND TRP-380. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L26232 mRNA. Translation: AAA36443.1. AB076694 mRNA. Translation: BAB79630.1. AL008726 Genomic DNA. Translation: CAA15499.1. AK289371 mRNA. Translation: BAF82060.1. AL008726 Genomic DNA. Translation: CAC36020.1. AY509570 Genomic DNA. Translation: AAR87775.1. CH471077 Genomic DNA. Translation: EAW75782.1. CH471077 Genomic DNA. Translation: EAW75781.1. CH471077 Genomic DNA. Translation: EAW75783.1. CH471077 Genomic DNA. Translation: EAW75785.1. CH471077 Genomic DNA. Translation: EAW75787.1. BC005045 mRNA. Translation: AAH05045.1. BC019847 mRNA. Translation: AAH19847.1. BC019898 mRNA. Translation: AAH19898.1. |
| IPI | IPI00217778. IPI01010596. |
| PIR | A53533. |
| RefSeq | NP_001229850.1. NM_001242921.1. NP_006218.1. NM_006227.3. NP_872617.1. NM_182676.2. |
| UniGene | Hs.439312. |
3D structure databases | |
| ProteinModelPortal | P55058. |
| SMR | P55058. Positions 18-465. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P55058. |
Protein family/group databases | |
| TCDB | 1.C.40.1.4. bactericidal permeability increasing protein (BPIP) family. |
PTM databases | |
| PhosphoSite | P55058. |
Polymorphism databases | |
| DMDM | 1709662. |
Proteomic databases | |
| PRIDE | P55058. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000372431; ENSP00000361508; ENSG00000100979. ENST00000477313; ENSP00000417138; ENSG00000100979. |
| GeneID | 5360. |
| KEGG | hsa:5360. |
| UCSC | uc002xql.1. human. uc002xqo.1. human. |
Organism-specific databases | |
| CTD | 5360. |
| GeneCards | GC20M044528. |
| H-InvDB | HIX0015869. |
| HGNC | HGNC:9093. PLTP. |
| HPA | CAB032873. |
| MIM | 172425. gene. |
| neXtProt | NX_P55058. |
| PharmGKB | PA273. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG16339. |
| HOVERGEN | HBG103156. |
| InParanoid | P55058. |
| OMA | TNHAGFL. |
| PhylomeDB | P55058. |
Enzyme and pathway databases | |
| Reactome | REACT_22258. Metabolism of lipids and lipoproteins. |
Gene expression databases | |
| ArrayExpress | P55058. |
| Bgee | P55058. |
| CleanEx | HS_PLTP. |
| Genevestigator | P55058. |
| GermOnline | ENSG00000100979. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR017943. Bactericidal_perm-incr_a/b_dom. IPR001124. Lipid-bd_serum_glycop_C. IPR017954. Lipid-bd_serum_glycop_CS. IPR017942. Lipid-bd_serum_glycop_N. [Graphical view] |
| KO | K08761. |
| Pfam | PF01273. LBP_BPI_CETP. 1 hit. PF02886. LBP_BPI_CETP_C. 1 hit. [Graphical view] |
| SMART | SM00328. BPI1. 1 hit. SM00329. BPI2. 1 hit. [Graphical view] |
| SUPFAM | SSF55394. Bactericidal_perm-incr_a/b_dom. 2 hits. |
| PROSITE | PS00400. LBP_BPI_CETP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20778. |
| PMAP-CutDB | P55058. |
| SOURCE | Search... |
Entry information
| Entry name | PLTP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P55058 Secondary accession number(s): A8K006 Q9BSH8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with