Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipid transfer protein

Gene

PLTP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Facilitates the transfer of a spectrum of different lipid molecules, including diacylglycerol, phosphatidic acid, sphingomyelin, phosphatidylcholine, phosphatidylglycerol, cerebroside and phosphatidyl ethanolamine. Essential for the transfer of excess surface lipids from triglyceride-rich lipoproteins to HDL, thereby facilitating the formation of smaller lipoprotein remnants, contributing to the formation of LDL, and assisting in the maturation of HDL particles. PLTP also plays a key role in the uptake of cholesterol from peripheral cells and tissues that is subsequently transported to the liver for degradation and excretion. Two distinct forms of PLTP exist in plasma: an active form that can transfer PC from phospholipid vesicles to high-density lipoproteins (HDL), and an inactive form that lacks this capability.

GO - Molecular functioni

GO - Biological processi

  • flagellated sperm motility Source: Ensembl
  • high-density lipoprotein particle remodeling Source: AgBase
  • lipid metabolic process Source: ProtInc
  • lipid transport Source: UniProtKB-KW
  • positive regulation of cholesterol efflux Source: AgBase
  • vitamin E biosynthetic process Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100979-MONOMER.
ReactomeiR-HSA-194223. HDL-mediated lipid transport.
SignaLinkiP55058.

Protein family/group databases

TCDBi1.C.40.1.4. the bactericidal permeability increasing protein (bpip) family.

Chemistry databases

SwissLipidsiSLP:000000469.

Names & Taxonomyi

Protein namesi
Recommended name:
Phospholipid transfer protein
Alternative name(s):
Lipid transfer protein II
Gene namesi
Name:PLTP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:9093. PLTP.

Subcellular locationi

GO - Cellular componenti

  • extracellular region Source: ProtInc
  • extracellular space Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi5360.
OpenTargetsiENSG00000100979.
PharmGKBiPA273.

Chemistry databases

ChEMBLiCHEMBL5962.

Polymorphism and mutation databases

BioMutaiPLTP.
DMDMi1709662.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 171 PublicationAdd BLAST17
ChainiPRO_000001716218 – 493Phospholipid transfer proteinAdd BLAST476

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi64N-linked (GlcNAc...) (complex)3 Publications1
Glycosylationi94N-linked (GlcNAc...)1 Publication1
Glycosylationi117N-linked (GlcNAc...) (complex)1
Glycosylationi143N-linked (GlcNAc...)2 Publications1
Disulfide bondi146 ↔ 1851 Publication
Glycosylationi245N-linked (GlcNAc...) (complex)2 Publications1
Glycosylationi398N-linked (GlcNAc...)1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiP55058.
MaxQBiP55058.
PaxDbiP55058.
PeptideAtlasiP55058.
PRIDEiP55058.
TopDownProteomicsiP55058-1. [P55058-1]

PTM databases

iPTMnetiP55058.
PhosphoSitePlusiP55058.
UniCarbKBiP55058.

Miscellaneous databases

PMAP-CutDBP55058.

Expressioni

Tissue specificityi

Wide tissue distribution. Placenta > pancreas > lung > kidney > heart > liver > skeletal muscle > brain.

Gene expression databases

BgeeiENSG00000100979.
CleanExiHS_PLTP.
GenevisibleiP55058. HS.

Organism-specific databases

HPAiCAB032873.
HPA047207.

Interactioni

Protein-protein interaction databases

BioGridi111374. 32 interactors.
STRINGi9606.ENSP00000361508.

Chemistry databases

BindingDBiP55058.

Structurei

3D structure databases

ProteinModelPortaliP55058.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG4160. Eukaryota.
ENOG410Z88E. LUCA.
GeneTreeiENSGT00730000110583.
HOGENOMiHOG000231006.
HOVERGENiHBG103156.
InParanoidiP55058.
KOiK08761.
OMAiLNQQICP.
OrthoDBiEOG091G058L.
PhylomeDBiP55058.
TreeFamiTF315617.

Family and domain databases

InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
IPR030675. BPI/LBP.
IPR032942. BPI/LBP/Plunc.
IPR001124. Lipid-bd_serum_glycop_C.
IPR017954. Lipid-bd_serum_glycop_CS.
IPR017942. Lipid-bd_serum_glycop_N.
IPR030179. PLTP.
[Graphical view]
PANTHERiPTHR10504. PTHR10504. 1 hit.
PTHR10504:SF16. PTHR10504:SF16. 1 hit.
PfamiPF01273. LBP_BPI_CETP. 1 hit.
PF02886. LBP_BPI_CETP_C. 1 hit.
[Graphical view]
PIRSFiPIRSF002417. Lipid_binding_protein. 1 hit.
SMARTiSM00328. BPI1. 1 hit.
SM00329. BPI2. 1 hit.
[Graphical view]
SUPFAMiSSF55394. SSF55394. 2 hits.
PROSITEiPS00400. LBP_BPI_CETP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P55058-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALFGALFLA LLAGAHAEFP GCKIRVTSKA LELVKQEGLR FLEQELETIT
60 70 80 90 100
IPDLRGKEGH FYYNISEVKV TELQLTSSEL DFQPQQELML QITNASLGLR
110 120 130 140 150
FRRQLLYWFF YDGGYINASA EGVSIRTGLE LSRDPAGRMK VSNVSCQASV
160 170 180 190 200
SRMHAAFGGT FKKVYDFLST FITSGMRFLL NQQICPVLYH AGTVLLNSLL
210 220 230 240 250
DTVPVRSSVD ELVGIDYSLM KDPVASTSNL DMDFRGAFFP LTERNWSLPN
260 270 280 290 300
RAVEPQLQEE ERMVYVAFSE FFFDSAMESY FRAGALQLLL VGDKVPHDLD
310 320 330 340 350
MLLRATYFGS IVLLSPAVID SPLKLELRVL APPRCTIKPS GTTISVTASV
360 370 380 390 400
TIALVPPDQP EVQLSSMTMD ARLSAKMALR GKALRTQLDL RRFRIYSNHS
410 420 430 440 450
ALESLALIPL QAPLKTMLQI GVMPMLNERT WRGVQIPLPE GINFVHEVVT
460 470 480 490
NHAGFLTIGA DLHFAKGLRE VIEKNRPADV RASTAPTPST AAV
Length:493
Mass (Da):54,739
Last modified:October 1, 1996 - v1
Checksum:iC6E4852F18E12317
GO
Isoform 2 (identifier: P55058-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-162: FYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFK → L

Show »
Length:441
Mass (Da):49,272
Checksum:i4D7435F89F79ABAA
GO
Isoform 3 (identifier: P55058-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-162: Missing.

Note: No experimental confirmation available.
Show »
Length:398
Mass (Da):44,135
Checksum:i6D2141C6899E98CB
GO
Isoform 4 (identifier: P55058-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-88: Missing.

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):44,847
Checksum:iB916DC8F704401C0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti18E → V in AAH19847 (PubMed:15489334).Curated1
Sequence conflicti18E → V in AAH19898 (PubMed:15489334).Curated1
Sequence conflicti331A → V in BAG61226 (PubMed:14702039).Curated1
Sequence conflicti375A → S in BAG56696 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_018879124S → Y.1 PublicationCorresponds to variant rs11569636dbSNPEnsembl.1
Natural variantiVAR_017020282R → Q.1 PublicationCorresponds to variant rs56126980dbSNPEnsembl.1
Natural variantiVAR_017021372R → H.1 PublicationCorresponds to variant rs144710772dbSNPEnsembl.1
Natural variantiVAR_017022380R → W.1 PublicationCorresponds to variant rs6065903dbSNPEnsembl.1
Natural variantiVAR_018880425M → I.1 PublicationCorresponds to variant rs11569675dbSNPEnsembl.1
Natural variantiVAR_012073444F → L.Corresponds to variant rs1804161dbSNPEnsembl.1
Natural variantiVAR_012074487T → K.Corresponds to variant rs1056929dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0540281 – 88Missing in isoform 4. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_04587768 – 162Missing in isoform 3. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_003050110 – 162FYDGG…GGTFK → L in isoform 2. 2 PublicationsAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L26232 mRNA. Translation: AAA36443.1.
AB076694 mRNA. Translation: BAB79630.1.
AL008726 Genomic DNA. Translation: CAA15499.1.
AK289371 mRNA. Translation: BAF82060.1.
AK293150 mRNA. Translation: BAG56696.1.
AK299181 mRNA. Translation: BAG61226.1.
AL008726 Genomic DNA. Translation: CAC36020.1.
AY509570 Genomic DNA. Translation: AAR87775.1.
CH471077 Genomic DNA. Translation: EAW75782.1.
CH471077 Genomic DNA. Translation: EAW75781.1.
CH471077 Genomic DNA. Translation: EAW75783.1.
CH471077 Genomic DNA. Translation: EAW75785.1.
CH471077 Genomic DNA. Translation: EAW75787.1.
BC005045 mRNA. Translation: AAH05045.1.
BC019847 mRNA. Translation: AAH19847.1.
BC019898 mRNA. Translation: AAH19898.1.
CCDSiCCDS13386.1. [P55058-1]
CCDS13387.1. [P55058-2]
CCDS56196.1. [P55058-4]
CCDS56197.1. [P55058-3]
PIRiA53533.
RefSeqiNP_001229849.1. NM_001242920.1. [P55058-3]
NP_001229850.1. NM_001242921.1. [P55058-4]
NP_006218.1. NM_006227.3. [P55058-1]
NP_872617.1. NM_182676.2. [P55058-2]
UniGeneiHs.439312.

Genome annotation databases

EnsembliENST00000354050; ENSP00000335290; ENSG00000100979. [P55058-2]
ENST00000372420; ENSP00000361497; ENSG00000100979. [P55058-4]
ENST00000372431; ENSP00000361508; ENSG00000100979. [P55058-1]
ENST00000420868; ENSP00000411671; ENSG00000100979. [P55058-3]
ENST00000477313; ENSP00000417138; ENSG00000100979. [P55058-1]
GeneIDi5360.
KEGGihsa:5360.
UCSCiuc002xql.3. human. [P55058-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L26232 mRNA. Translation: AAA36443.1.
AB076694 mRNA. Translation: BAB79630.1.
AL008726 Genomic DNA. Translation: CAA15499.1.
AK289371 mRNA. Translation: BAF82060.1.
AK293150 mRNA. Translation: BAG56696.1.
AK299181 mRNA. Translation: BAG61226.1.
AL008726 Genomic DNA. Translation: CAC36020.1.
AY509570 Genomic DNA. Translation: AAR87775.1.
CH471077 Genomic DNA. Translation: EAW75782.1.
CH471077 Genomic DNA. Translation: EAW75781.1.
CH471077 Genomic DNA. Translation: EAW75783.1.
CH471077 Genomic DNA. Translation: EAW75785.1.
CH471077 Genomic DNA. Translation: EAW75787.1.
BC005045 mRNA. Translation: AAH05045.1.
BC019847 mRNA. Translation: AAH19847.1.
BC019898 mRNA. Translation: AAH19898.1.
CCDSiCCDS13386.1. [P55058-1]
CCDS13387.1. [P55058-2]
CCDS56196.1. [P55058-4]
CCDS56197.1. [P55058-3]
PIRiA53533.
RefSeqiNP_001229849.1. NM_001242920.1. [P55058-3]
NP_001229850.1. NM_001242921.1. [P55058-4]
NP_006218.1. NM_006227.3. [P55058-1]
NP_872617.1. NM_182676.2. [P55058-2]
UniGeneiHs.439312.

3D structure databases

ProteinModelPortaliP55058.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111374. 32 interactors.
STRINGi9606.ENSP00000361508.

Chemistry databases

BindingDBiP55058.
ChEMBLiCHEMBL5962.
SwissLipidsiSLP:000000469.

Protein family/group databases

TCDBi1.C.40.1.4. the bactericidal permeability increasing protein (bpip) family.

PTM databases

iPTMnetiP55058.
PhosphoSitePlusiP55058.
UniCarbKBiP55058.

Polymorphism and mutation databases

BioMutaiPLTP.
DMDMi1709662.

Proteomic databases

EPDiP55058.
MaxQBiP55058.
PaxDbiP55058.
PeptideAtlasiP55058.
PRIDEiP55058.
TopDownProteomicsiP55058-1. [P55058-1]

Protocols and materials databases

DNASUi5360.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354050; ENSP00000335290; ENSG00000100979. [P55058-2]
ENST00000372420; ENSP00000361497; ENSG00000100979. [P55058-4]
ENST00000372431; ENSP00000361508; ENSG00000100979. [P55058-1]
ENST00000420868; ENSP00000411671; ENSG00000100979. [P55058-3]
ENST00000477313; ENSP00000417138; ENSG00000100979. [P55058-1]
GeneIDi5360.
KEGGihsa:5360.
UCSCiuc002xql.3. human. [P55058-1]

Organism-specific databases

CTDi5360.
DisGeNETi5360.
GeneCardsiPLTP.
HGNCiHGNC:9093. PLTP.
HPAiCAB032873.
HPA047207.
MIMi172425. gene.
neXtProtiNX_P55058.
OpenTargetsiENSG00000100979.
PharmGKBiPA273.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4160. Eukaryota.
ENOG410Z88E. LUCA.
GeneTreeiENSGT00730000110583.
HOGENOMiHOG000231006.
HOVERGENiHBG103156.
InParanoidiP55058.
KOiK08761.
OMAiLNQQICP.
OrthoDBiEOG091G058L.
PhylomeDBiP55058.
TreeFamiTF315617.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100979-MONOMER.
ReactomeiR-HSA-194223. HDL-mediated lipid transport.
SignaLinkiP55058.

Miscellaneous databases

GeneWikiiPhospholipid_transfer_protein.
GenomeRNAii5360.
PMAP-CutDBP55058.
PROiP55058.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100979.
CleanExiHS_PLTP.
GenevisibleiP55058. HS.

Family and domain databases

InterProiIPR017943. Bactericidal_perm-incr_a/b_dom.
IPR030675. BPI/LBP.
IPR032942. BPI/LBP/Plunc.
IPR001124. Lipid-bd_serum_glycop_C.
IPR017954. Lipid-bd_serum_glycop_CS.
IPR017942. Lipid-bd_serum_glycop_N.
IPR030179. PLTP.
[Graphical view]
PANTHERiPTHR10504. PTHR10504. 1 hit.
PTHR10504:SF16. PTHR10504:SF16. 1 hit.
PfamiPF01273. LBP_BPI_CETP. 1 hit.
PF02886. LBP_BPI_CETP_C. 1 hit.
[Graphical view]
PIRSFiPIRSF002417. Lipid_binding_protein. 1 hit.
SMARTiSM00328. BPI1. 1 hit.
SM00329. BPI2. 1 hit.
[Graphical view]
SUPFAMiSSF55394. SSF55394. 2 hits.
PROSITEiPS00400. LBP_BPI_CETP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPLTP_HUMAN
AccessioniPrimary (citable) accession number: P55058
Secondary accession number(s): A8K006
, B4DDD5, B4DRB4, E1P5N8, E7EV16, Q8WTT1, Q9BR07, Q9BSH8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 2, 2016
This is version 161 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.