P54821 (PRRX1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Paired mesoderm homeobox protein 1 Alternative name(s): Homeobox protein PHOX1 Paired-related homeobox protein 1 Short name=PRX-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 245 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer By similarity. |
| Subcellular location | |
| Involvement in disease | Defects in PRRX1 are the cause of agnathia-otocephaly complex (AGOTC) [MIM:202650]. AGOTC is a rare condition characterized by mandibular hypoplasia or agnathia, ventromedial auricular malposition (melotia) and/or auricular fusion (synotia), and microstomia with oroglossal hypoplasia or aglossia. Holoprosencephaly is the most commonly identified association, but skeletal, genitourinary, and cardiovascular anomalies, and situs inversus have been reported. The disorder is almost always lethal. Ref.5 |
| Sequence similarities | Belongs to the paired homeobox family. Contains 1 homeobox DNA-binding domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Disease | Disease mutation |
| Domain | Homeobox |
| Ligand | DNA-binding |
| Molecular function | Developmental protein |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | multicellular organismal development Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | sequence-specific DNA binding Inferred from electronic annotation. Source: InterPro sequence-specific DNA binding transcription factor activityInferred from electronic annotation. Source: InterPro transcription coactivator activityTraceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PMX1-B (identifier: P54821-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PMX1-A (identifier: P54821-2) The sequence of this isoform differs from the canonical sequence as follows: 200-245: SAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN → RSSSLPRCCLHEGLHNGF |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 245 | 245 | Paired mesoderm homeobox protein 1 | PRO_0000049251 | |||||
Regions | |||||||||
| DNA binding | 94 – 153 | 60 | Homeobox | ||||||
| Motif | 222 – 235 | 14 | OAR | ||||||
Amino acid modifications | |||||||||
| Modified residue | 197 | 1 | Phosphoserine Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 200 – 245 | 46 | SAMAT…VPTVN → RSSSLPRCCLHEGLHNGF in isoform PMX1-A. | VSP_002278 | |||||
| Natural variant | 113 | 1 | F → S in AGOTC. Ref.5 | VAR_066414 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human protein factory for converting the transcriptome into an in vitro-expressed proteome." Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. Nomura N.Nat. Methods 5:1011-1017(2008) [PubMed: 19054851] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PMX1-B). |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PMX1-B). |
| [4] | "Human and Drosophila homeodomain proteins that enhance the DNA-binding activity of serum response factor." Grueneberg D.A., Natesan S., Alexandre C., Gilman M.Z. Science 257:1089-1095(1992) [PubMed: 1509260] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 19-197 (ISOFORM PMX1-A). |
| [5] | "PRRX1 is mutated in a fetus with agnathia-otocephaly." Sergi C., Kamnasaran D. Clin. Genet. 79:293-295(2011) [PubMed: 21294718] [Abstract] Cited for: VARIANT AGOTC SER-113. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB451463 mRNA. Translation: BAG70277.1. Z97200 Genomic DNA. No translation available. BC074993 mRNA. Translation: AAH74993.1. M95929 mRNA. Translation: AAA60085.1. |
| IPI | IPI00008822. IPI00221036. |
| RefSeq | NP_008833.1. NM_006902.3. NP_073207.1. NM_022716.2. |
| UniGene | Hs.283416. |
3D structure databases | |
| ProteinModelPortal | P54821. |
| SMR | P54821. Positions 94-150. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P54821. |
Polymorphism databases | |
| DMDM | 6174916. |
Proteomic databases | |
| PRIDE | P54821. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000367760; ENSP00000356734; ENSG00000116132. |
| GeneID | 5396. |
| KEGG | hsa:5396. |
| UCSC | uc001ghe.1. human. uc001ghf.1. human. |
Organism-specific databases | |
| CTD | 5396. |
| GeneCards | GC01P170632. |
| HGNC | HGNC:9142. PRRX1. |
| MIM | 167420. gene. 202650. phenotype. |
| neXtProt | NX_P54821. |
| Orphanet | 990. Agnathia - holoprosencephaly - situs inversus. |
| PharmGKB | PA33466. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11709. |
| GeneTree | ENSGT00600000084045. |
| HOGENOM | HBG717557. |
| HOVERGEN | HBG021349. |
| InParanoid | P54821. |
| OMA | MATYPPT. |
| OrthoDB | EOG4RR6J8. |
| PhylomeDB | P54821. |
Gene expression databases | |
| ArrayExpress | P54821. |
| Bgee | P54821. |
| CleanEx | HS_PRRX1. |
| Genevestigator | P54821. |
| GermOnline | ENSG00000116132. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003654. Homeo_OAR. IPR001356. Homeobox. IPR017970. Homeobox_CS. IPR009057. Homeodomain-like. IPR012287. Homeodomain-rel. [Graphical view] |
| Gene3D | G3DSA:1.10.10.60. Homeodomain-rel. 1 hit. |
| KO | K09329. |
| Pfam | PF00046. Homeobox. 1 hit. PF03826. OAR. 1 hit. [Graphical view] |
| SMART | SM00389. HOX. 1 hit. [Graphical view] |
| SUPFAM | SSF46689. Homeodomain_like. 1 hit. |
| PROSITE | PS00027. HOMEOBOX_1. 1 hit. PS50071. HOMEOBOX_2. 1 hit. PS50803. OAR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20925. |
| SOURCE | Search... |
Entry information
| Entry name | PRRX1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P54821 Secondary accession number(s): B5BUM7, O60807 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with