Reviewed,
UniProtKB/Swiss-Prot P54821 (PRRX1_HUMAN)
Last modified
November 25, 2008.
Version 76.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Paired mesoderm homeobox protein 1 Alternative name(s): Paired-related homeobox protein 1 Short name=PRX-1 Homeobox protein PHOX1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 245 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Acts as a transcriptional regulator of muscle creatine kinase (MCK) and so has a role in the establishment of diverse mesodermal muscle types. The protein binds to an A/T-rich element in the muscle creatine enhancer By similarity. |
| Subcellular location | |
| Sequence similarities | Belongs to the paired homeobox family. Contains 1 homeobox DNA-binding domain. Contains 1 OAR domain. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Homeobox |
| Ligand | DNA-binding |
| Molecular function | Developmental protein |
| PTM | Phosphoprotein |
Gene Ontology (GO) | |
| Biological process | multicellular organismal development Inferred from electronic annotation. Source: InterPro regulation of transcription, DNA-dependentInferred from electronic annotation. Source: InterPro |
| Cellular component | nucleus Inferred from electronic annotation. Source: InterPro |
| Molecular function | sequence-specific DNA binding Inferred from electronic annotation. Source: InterPro transcription coactivator activity Ref.3Traceable author statement. Source: ProtInc transcription factor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PMX1-B (identifier: P54821-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PMX1-A (identifier: P54821-2) The sequence of this isoform differs from the canonical sequence as follows: 200-245: SAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN → RSSSLPRCCLHEGLHNGF |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 245 | 245 | Paired mesoderm homeobox protein 1 | PRO_0000049251 | |||||
Regions | |||||||||
| DNA binding | 94 – 153 | 60 | Homeobox | ||||||
| Motif | 222 – 235 | 14 | OAR | ||||||
Amino acid modifications | |||||||||
| Modified residue | 197 | 1 | Phosphoserine Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 200 – 245 | 46 | SAMAT…VPTVN → RSSSLPRCCLHEGLHNGF in isoform PMX1-A. | VSP_002278 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PMX1-B). |
| [3] | "Human and Drosophila homeodomain proteins that enhance the DNA-binding activity of serum response factor." Grueneberg D.A., Natesan S., Alexandre C., Gilman M.Z. Science 257:1089-1095(1992) [PubMed: 1509260] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 19-197 (ISOFORM PMX1-A). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| Z97200 Genomic DNA. No translation available. BC074993 mRNA. Translation: AAH74993.1. M95929 mRNA. Translation: AAA60085.1. | |
| RefSeq | NP_008833.1. NP_073207.1. |
| UniGene | Hs.702224 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1FJL based on UniProtKB P06601. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P54821. |
Genome annotation databases | |
| Ensembl | ENSG00000116132. Homo sapiens. [Contig view] |
| GeneID | 5396. |
| KEGG | hsa:5396. |
Organism-specific databases | |
| H-InvDB | HIX0028796. |
| HGNC | HGNC:9142. PRRX1. |
| MIM | 167420. gene. |
| PharmGKB | PA33466. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | P54821. |
| HOVERGEN | P54821. |
Gene expression databases | |
| ArrayExpress | P54821. |
| CleanEx | HS_PRRX1. |
| GermOnline | ENSG00000116132. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003654. Homeo_OAR. IPR001356. Homeobox. IPR012287. Homeodomain-rel. [Graphical view] |
| Gene3D | G3DSA:1.10.10.60. Homeodomain-rel. 1 hit. |
| Pfam | PF00046. Homeobox. 1 hit. PF03826. OAR. 1 hit. [Graphical view] |
| PRINTS | PR00024. HOMEOBOX. |
| ProDom | PD000010. Homeobox. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00389. HOX. 1 hit. [Graphical view] |
| PROSITE | PS00027. HOMEOBOX_1. 1 hit. PS50071. HOMEOBOX_2. 1 hit. PS50803. OAR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 20925. |
| SOURCE | Search... |
Entry information
| Entry name | PRRX1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P54821 Secondary accession number(s): O60807 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


