Reviewed,
UniProtKB/Swiss-Prot P54803 (GALC_HUMAN)
Last modified
June 16, 2009.
Version 88.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Galactocerebrosidase Short name=GALCERase EC=3.2.1.46 Alternative name(s): Galactosylceramidase Galactosylceramide beta-galactosidase Galactocerebroside beta-galactosidase | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 685 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Enzyme with very low activity responsible for the lysosomal catabolism of galactosylceramide, a major lipid in myelin, kidney and epithelial cells of small intestine and colon. |
| Catalytic activity | D-galactosyl-N-acylsphingosine + H2O = D-galactose + N-acylsphingosine. |
| Subcellular location | |
| Tissue specificity | Highest level of activity in testes compared to brain, kidney, placenta and liver. Can also be found in urine. |
| Polymorphism | Polymorphic amino-acid changes are responsible for the wide range of catalytic activities found in the general population. |
| Involvement in disease | Defects in GALC are the cause of leukodystrophy globoid cell (GLD) [MIM:245200]; also known as Krabbe disease. This autosomal recessive disorder results in the insufficient catabolism of several galactolipids that are important in the production of normal myelin. Clinically, the most frequent form is the infantile form. Most patients (90%) present before six months of age with irritability, spasticity, arrest of motor and mental development, and bouts of temperature elevation without infection. This is followed by myoclonic jerks of arms and legs, oposthotonus, hypertonic fits, and mental regression, which progresses to a severe decerebrate condition with no voluntary movements and death from respiratory infections or cerebral hyperpyrexia before 2 years of age. However, a significant number of cases with later onset, presenting with unexplained blindness, weakness and/or progressive motor, and sensory neuropathy that can progress to severe mental incapacity and death, have been identified. |
| Sequence similarities | Belongs to the glycosyl hydrolase 59 family. |
| Caution | It is uncertain whether Met-1 or Met-17 is the initiator. |
| biophysicochemical properties | pH dependence: Optimum pH is 4.0-4.4. Temperature dependence: Activity is lost after heating at 52 degrees Celsius for five minutes. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Lysosome |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Leukodystrophy |
| Domain | Signal |
| Molecular function | Glycosidase Hydrolase |
| PTM | Glycoprotein |
| Technical term | Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | carbohydrate metabolic process Inferred from electronic annotation. Source: InterPro galactosylceramide catabolic processInferred from electronic annotation. Source: InterPro |
| Cellular component | lysosome Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | cation binding Inferred from electronic annotation. Source: InterPro galactosylceramidase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P54803-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P54803-2) The sequence of this isoform differs from the canonical sequence as follows: 388-407: SHKHSKCIRPFLPYFNVSQQ → VNFCCCYWINSLLYYWKNKI 408-685: Missing. | ||||||
| Isoform 3 (identifier: P54803-3) The sequence of this isoform differs from the canonical sequence as follows: 66-88: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: P54803-4) The sequence of this isoform differs from the canonical sequence as follows: 1-65: MAEWLLSASW...DGIGAVSGGG → MLGKSHGRAT...HQVTPEEKPA | ||||||
| Isoform 5 (identifier: P54803-5) The sequence of this isoform differs from the canonical sequence as follows: 1-65: MAEWLLSASWQRRAKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGAVSGGG → MGFMVADLW 638-685: GHFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFLVEATR → VAGRRKKT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 42 | 42 | Ref.5 Ref.8 | ||||||
| Chain | 43 – 685 | 643 | Galactocerebrosidase | PRO_0000012230 | |||||
Amino acid modifications | |||||||||
| Glycosylation | 143 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 379 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 403 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 556 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 559 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 602 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 65 | 65 | MAEWL…VSGGG → MLGKSHGRATHGPLPLTDLG IHLPCVKVLHQVTPEEKPA in isoform 4. | VSP_036974 | |||||
| Alternative sequence | 1 – 65 | 65 | MAEWL…VSGGG → MGFMVADLW in isoform 5. | VSP_036975 | |||||
| Alternative sequence | 66 – 88 | 23 | Missing in isoform 3. | VSP_036976 | |||||
| Alternative sequence | 388 – 407 | 20 | SHKHS…NVSQQ → VNFCCCYWINSLLYYWKNKI in isoform 2. | VSP_001800 | |||||
| Alternative sequence | 408 – 685 | 278 | Missing in isoform 2. | VSP_001801 | |||||
| Alternative sequence | 638 – 685 | 48 | GHFAS…VEATR → VAGRRKKT in isoform 5. | VSP_036977 | |||||
| Natural variant | 59 | 1 | G → R in GLD; infantile; significant reduction of activity. Ref.18 | VAR_013956 | |||||
| Natural variant | 68 | 1 | S → F in GLD; infantile; significant reduction of activity. Ref.18 | VAR_013957 | |||||
| Natural variant | 79 | 1 | R → H in GLD. Ref.13 | VAR_013958 | |||||
| Natural variant | 82 | 1 | I → M in GLD; adult; reduction of activity; when associated with V-2105. Ref.16 | VAR_013959 | |||||
| Natural variant | 111 | 1 | G → D in GLD. Ref.13 | VAR_003380 | |||||
| Natural variant | 111 | 1 | G → S in GLD. Ref.13 | VAR_003381 | |||||
| Natural variant | 112 | 1 | T → A in GLD; adult. | VAR_003382 | |||||
| Natural variant | 117 | 1 | M → L in GLD; adult. Ref.13 | VAR_003383 | |||||
| Natural variant | 184 | 1 | R → C: dbSNP rs1805078. Ref.3 Ref.11 | VAR_013960 | |||||
| Natural variant | 187 | 1 | D → V in GLD. | VAR_003384 | |||||
| Natural variant | 194 | 1 | G → A in GLD. | VAR_003385 | |||||
| Natural variant | 248 | 1 | D → N: dbSNP rs34362748. | VAR_003386 | |||||
| Natural variant | 250 | 1 | I → T in GLD; late infantile. Ref.13 | VAR_003387 | |||||
| Natural variant | 263 | 1 | A → T in GLD. | VAR_003388 | |||||
| Natural variant | 278 | 1 | T → I in GLD; infantile; significant reduction of activity. Ref.18 | VAR_013961 | |||||
| Natural variant | 284 | 1 | G → S in GLD. Ref.13 | VAR_003389 | |||||
| Natural variant | 286 | 1 | G → D in GLD. Ref.16 Ref.17 | VAR_003390 | |||||
| Natural variant | 295 | 1 | N → T in GLD. | VAR_003391 | |||||
| Natural variant | 303 | 1 | S → F in GLD; infantile. | VAR_003392 | |||||
| Natural variant | 305 | 1 | I → V: dbSNP rs1805079. Ref.16 | VAR_013962 | |||||
| Natural variant | 314 | 1 | Y → C in GLD. Ref.13 | VAR_013963 | |||||
| Natural variant | 318 | 1 | P → A in GLD. Ref.12 | VAR_003393 | |||||
| Natural variant | 335 | 1 | Y → C in GLD; infantile; significant reduction of activity. Ref.18 | VAR_013964 | |||||
| Natural variant | 396 | 1 | R → W in GLD; bilateral cherry red spots. | VAR_003394 | |||||
| Natural variant | 400 | 1 | P → L in GLD. | VAR_003395 | |||||
| Natural variant | 426 | 1 | W → G in GLD; infantile; significant reduction of activity. Ref.18 | VAR_013965 | |||||
| Natural variant | 468 | 1 | T → S in GLD. | VAR_003396 | |||||
| Natural variant | 514 | 1 | F → S in GLD. | VAR_003397 | |||||
| Natural variant | 529 | 1 | T → M in GLD; infantile. | VAR_003398 | |||||
| Natural variant | 531 | 1 | R → C in GLD. Ref.18 | VAR_003399 | |||||
| Natural variant | 531 | 1 | R → H in GLD; infantile; significant reduction of activity. Ref.18 | VAR_013966 | |||||
| Natural variant | 544 | 1 | D → N in GLD; Arab patients. Ref.15 | VAR_003400 | |||||
| Natural variant | 553 | 1 | G → R in GLD; loss of activity. Ref.17 | VAR_013967 | |||||
| Natural variant | 562 | 1 | I → T Common polymorphism. dbSNP rs398607. Ref.13 Ref.16 Ref.3 Ref.1 Ref.7 | VAR_003401 | |||||
| Natural variant | 566 | 1 | V → G in GLD. Ref.12 | VAR_003402 | |||||
| Natural variant | 567 | 1 | Y → S in GLD; belgian patient. | VAR_003403 | |||||
| Natural variant | 592 | 1 | A → S in GLD. | VAR_003404 | |||||
| Natural variant | 599 | 1 | I → S in GLD; infantile; Druze patients. Ref.15 | VAR_003405 | |||||
| Natural variant | 634 | 1 | L → S in GLD; adult. Ref.16 | VAR_013968 | |||||
| Natural variant | 641 | 1 | A → T Significant reduction of activity when associated with T-562. dbSNP rs421262. Ref.17 Ref.4 | VAR_003406 | |||||
| Natural variant | 645 | 1 | L → R in GLD; adult. | VAR_003407 | |||||
| Natural variant | 668 | 1 | T → R in GLD; infantile; significant reduction of activity. Ref.18 | VAR_013969 | |||||
Experimental info | |||||||||
| Sequence conflict | 78 | 1 | Y → H in BAH13778. Ref.1 | ||||||
| Sequence conflict | 195 | 1 | I → T in BAG64110. Ref.1 | ||||||
| Sequence conflict | 422 | 1 | E → G in BAG64110. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure and organization of the human galactocerebrosidase (GALC) gene." Luzi P., Rafi M.A., Wenger D.A. Genomics 26:407-409(1995) [PubMed: 7601472] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-562. |
| [2] | "Human galactocerebrosidase gene: promoter analysis of the 5'-flanking region and structural organization." Sakai N., Fukushima H., Inui K., Fu L., Nishigaki T., Yanagihara I., Tatsumi N., Ozono K., Okada S. Biochim. Biophys. Acta 1395:62-67(1998) [PubMed: 9434153] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 2-685 (ISOFORM 3), VARIANTS CYS-184 AND THR-562. Tissue: Testis and Thalamus. |
| [4] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed: 12508121] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-641. |
| [5] | "Cloning and expression of cDNA encoding human galactocerebrosidase, the enzyme deficient in globoid cell leukodystrophy." Chen Y.Q., Rafi M.A., de Gala G., Wenger D.A. Hum. Mol. Genet. 2:1841-1845(1993) [PubMed: 8281145] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 2-685 (ISOFORM 1), PROTEIN SEQUENCE OF 43-75 AND 452-470. Tissue: Testis. |
| [6] | "Krabbe disease: isolation and characterization of a full-length cDNA for human galactocerebrosidase." Sakai N., Inui K., Fujii N., Fukushima H., Nishimoto J., Yanagihara I., Isegawa Y., Iwamatsu A., Okada S. Biochem. Biophys. Res. Commun. 198:485-491(1994) [PubMed: 8297359] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 5-685 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 5-685 (ISOFORM 2), PARTIAL PROTEIN SEQUENCE. Tissue: Placenta and Skin fibroblast. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 15-685 (ISOFORM 1), VARIANT THR-562. Tissue: Testis. |
| [8] | "Galactocerebrosidase from human urine: purification and partial characterization." Chen Y.Q., Wenger D.A. Biochim. Biophys. Acta 1170:53-61(1993) [PubMed: 8399327] [Abstract] Cited for: PROTEIN SEQUENCE OF 43-61 AND 452-470, CHARACTERIZATION. Tissue: Urine. |
| [9] | "Molecular genetics of Krabbe disease (globoid cell leukodystrophy): diagnostic and clinical implications." Wenger D.A., Rafi M.A., Luzi P. Hum. Mutat. 10:268-279(1997) [PubMed: 9338580] [Abstract] Cited for: REVIEW ON GLD MUTATIONS. |
| [10] | "Krabbe disease: genetic aspects and progress toward therapy." Wenger D.A., Rafi M.A., Luzi P., Datto J., Costantino-Ceccarini E. Mol. Genet. Metab. 70:1-9(2000) [PubMed: 10833326] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [11] | "A large deletion together with a point mutation in the GALC gene is a common mutant allele in patients with infantile Krabbe disease." Rafi M.A., Luzi P., Chen Y.Q., Wenger D.A. Hum. Mol. Genet. 4:1285-1289(1995) [PubMed: 7581365] [Abstract] Cited for: VARIANT CYS-184. |
| [12] | "Molecular defects in Krabbe disease." Tatsumi N., Inui K., Sakai N., Fukushima H., Nishimoto J., Yanagihara I., Nishigaki T., Tsukamoto H., Fu L., Taniike M., Okada S. Hum. Mol. Genet. 4:1865-1868(1995) [PubMed: 8595408] [Abstract] Cited for: VARIANTS GLD ALA-318 AND GLY-566. |
| [13] | "Molecular heterogeneity of late-onset forms of globoid-cell leukodystrophy." De Gasperi R., Gama Sosa M.A., Sartorato E.L., Battistini S., MacFarlane H., Gusella J.F., Krivit W., Kolodny E.H. Am. J. Hum. Genet. 59:1233-1242(1996) [PubMed: 8940268] [Abstract] Cited for: VARIANTS GLD HIS-79; SER-111; LEU-117; THR-250; SER-284 AND CYS-314, VARIANT THR-562. |
| [14] | Erratum De Gasperi R., Gama Sosa M.A., Sartorato E.L., Battistini S., MacFarlane H., Gusella J.F., Krivit W., Kolodny E.H. Am. J. Hum. Genet. 60:1264-1264(1997) |
| [15] | "Two different mutations are responsible for Krabbe disease in the Druze and Moslem Arab populations in Israel." Rafi M.A., Luzi P., Zlotogora J., Wenger D.A. Hum. Genet. 97:304-308(1996) [PubMed: 8786069] [Abstract] Cited for: VARIANTS GLD ASN-544 AND SER-599. |
| [16] | "Adult onset globoid cell leukodystrophy (Krabbe disease): analysis of galactosylceramidase cDNA from four Japanese patients." Furuya H., Kukita Y.-J., Nagano S., Sakai Y., Yamashita Y., Fukuyama H., Inatomi Y., Saito Y., Koike R., Tsuji S., Fukumaki Y., Hayashi K., Kobayashi T. Hum. Genet. 100:450-456(1997) [PubMed: 9272171] [Abstract] Cited for: VARIANTS GLD MET-82; ASP-286 AND SER-634, VARIANTS VAL-305 AND THR-562. |
| [17] | "Molecular basis of late-life globoid cell leukodystrophy." De Gasperi R., Gama Sosa M.A., Sartorato E.L., Battistini S., Raghavan S., Kolodny E.H. Hum. Mutat. 14:256-262(1999) [PubMed: 10477434] [Abstract] Cited for: VARIANTS GLD ASP-286 AND ARG-553, VARIANT THR-641. |
| [18] | "Molecular heterogeneity of Krabbe disease." Fu L., Inui K., Nishigaki T., Tatsumi N., Tsukamoto H., Kokubu C., Muramatsu T., Okada S. J. Inherit. Metab. Dis. 22:155-162(1999) [PubMed: 10234611] [Abstract] Cited for: VARIANTS GLD ARG-59; PHE-68; ILE-278; CYS-335; GLY-426; HIS-531 AND ARG-668. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
L38559 L38558 Genomic DNA. Translation: AAA80975.1. Different initiation.D86181 Genomic DNA. Translation: BAA24902.1. Different initiation. AK296530 mRNA. Translation: BAG59160.1. Different initiation. AK302519 mRNA. Translation: BAG63793.1. AK302683 mRNA. Translation: BAH13778.1. AK302956 mRNA. Translation: BAG64110.1. AL136501 Genomic DNA. No translation available. AL157955 Genomic DNA. No translation available. L23116 mRNA. Translation: AAA16645.1. Different initiation. D25283 mRNA. Translation: BAA04971.1. Different initiation. D25284 mRNA. Translation: BAA04972.1. Different initiation. BC036518 mRNA. Translation: AAH36518.1. Different initiation. | |
| IPI | IPI00220546. IPI00872350. |
| PIR | I54205. |
| RefSeq | NP_000144.2. NP_001032614.1. |
| UniGene | Hs.513439 |
3D structure databases | |
| ModBase | Search... |
Protein family/group databases | |
| CAZy | GH59. Glycoside Hydrolase Family 59. |
Genome annotation databases | |
| Ensembl | ENSG00000054983. Homo sapiens. [Contig view] |
| GeneID | 2581. |
| KEGG | hsa:2581. |
Organism-specific databases | |
| GeneCards | GC14M087469. |
| H-InvDB | HIX0026669. |
| HGNC | HGNC:4115. GALC. |
| MIM | 245200. phenotype. 606890. gene. |
| Orphanet | 487. Krabbe disease. |
| PharmGKB | PA28530. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | P54803. |
| HOVERGEN | P54803. |
Enzyme and pathway databases | |
| BRENDA | 3.2.1.46. 247. |
Gene expression databases | |
| ArrayExpress | P54803. |
| Bgee | P54803. |
| CleanEx | HS_GALC. |
| GermOnline | ENSG00000054983. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001286. Glyco_hydro_59. IPR013781. Glyco_hydro_sg_catalytic. [Graphical view] |
| Gene3D | G3DSA:3.20.20.80. Glyco_hydro_cat. 1 hit. |
| PANTHER | PTHR15172. Glyco_hydro_59. 1 hit. |
| Pfam | PF02057. Glyco_hydro_59. 1 hit. [Graphical view] |
| PRINTS | PR00850. GLHYDRLASE59. |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 10207. |
| SOURCE | Search... |
Entry information
| Entry name | GALC_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P54803 Secondary accession number(s): B4DKE8 Q8J030 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Glycosyl hydrolases Classification of glycosyl hydrolase families and list of entries |
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


