Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ephrin type-B receptor 4

Gene

EPHB4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Together with its cognate ligand/functional ligand EFNB2 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and cell migration. EPHB4-mediated forward signaling controls cellular repulsion and segregation form EFNB2-expressing cells. Plays also a role in postnatal blood vessel remodeling, morphogenesis and permeability and is thus important in the context of tumor angiogenesis.2 Publications

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei647ATPPROSITE-ProRule annotation1
Active sitei740Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi621 – 629ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • ephrin receptor activity Source: UniProtKB
  • transmembrane receptor protein tyrosine kinase activity Source: UniProtKB

GO - Biological processi

  • angiogenesis Source: UniProtKB
  • cell adhesion Source: UniProtKB
  • cell migration involved in sprouting angiogenesis Source: UniProtKB
  • ephrin receptor signaling pathway Source: UniProtKB
  • heart morphogenesis Source: UniProtKB
  • protein autophosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Angiogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS02886-MONOMER.
BRENDAi2.7.10.1. 2681.
ReactomeiR-HSA-2682334. EPH-Ephrin signaling.
R-HSA-3928662. EPHB-mediated forward signaling.
R-HSA-3928664. Ephrin signaling.
R-HSA-3928665. EPH-ephrin mediated repulsion of cells.
SignaLinkiP54760.
SIGNORiP54760.

Names & Taxonomyi

Protein namesi
Recommended name:
Ephrin type-B receptor 4 (EC:2.7.10.1)
Alternative name(s):
Hepatoma transmembrane kinase
Tyrosine-protein kinase TYRO11
Gene namesi
Name:EPHB4
Synonyms:HTK, MYK1, TYRO11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:3395. EPHB4.

Subcellular locationi

  • Cell membrane 1 Publication; Single-pass type I membrane protein 1 Publication

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini16 – 539ExtracellularSequence analysisAdd BLAST524
Transmembranei540 – 560HelicalSequence analysisAdd BLAST21
Topological domaini561 – 987CytoplasmicSequence analysisAdd BLAST427

GO - Cellular componenti

  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • extracellular region Source: Reactome
  • integral component of plasma membrane Source: UniProtKB
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi95L → R: Reduces binding affinity for EFNB2. 1 Publication1

Organism-specific databases

DisGeNETi2050.
OpenTargetsiENSG00000196411.
PharmGKBiPA27827.

Chemistry databases

ChEMBLiCHEMBL5147.
GuidetoPHARMACOLOGYi1833.

Polymorphism and mutation databases

BioMutaiEPHB4.
DMDMi19860819.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 15Sequence analysisAdd BLAST15
ChainiPRO_000001683416 – 987Ephrin type-B receptor 4Add BLAST972

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi61 ↔ 184
Disulfide bondi97 ↔ 107
Glycosylationi203N-linked (GlcNAc...)Sequence analysis1
Glycosylationi335N-linked (GlcNAc...)Sequence analysis1
Glycosylationi426N-linked (GlcNAc...)Sequence analysis1
Modified residuei769PhosphoserineCombined sources1
Modified residuei770PhosphoserineCombined sources1
Modified residuei911PhosphoserineCombined sources1
Modified residuei943PhosphoserineCombined sources1
Modified residuei976PhosphothreonineCombined sources1
Modified residuei987PhosphotyrosineCombined sources1

Post-translational modificationi

Phosphorylated; autophosphorylation is stimulated by EFNB2.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiP54760.
PaxDbiP54760.
PeptideAtlasiP54760.
PRIDEiP54760.

2D gel databases

DOSAC-COBS-2DPAGEP54760.

PTM databases

iPTMnetiP54760.
PhosphoSitePlusiP54760.
SwissPalmiP54760.

Expressioni

Tissue specificityi

Abundantly expressed in placenta but also detected in kidney, liver, lung, pancreas, skeletal muscle and heart. Expressed in primitive and myeloid, but not lymphoid, hematopoietic cells. Also observed in cell lines derived from liver, breast, colon, lung, melanocyte and cervix.1 Publication

Developmental stagei

Expressed in fetal heart, lung, liver and to a lower extent in brain. Not expressed in adult brain.1 Publication

Gene expression databases

BgeeiENSG00000196411.
CleanExiHS_EPHB4.
ExpressionAtlasiP54760. baseline and differential.
GenevisibleiP54760. HS.

Organism-specific databases

HPAiCAB013537.

Interactioni

Subunit structurei

Heterotetramer upon binding of the ligand. The heterotetramer is composed of an ephrin dimer and a receptor dimer. Oligomerization is probably required to induce biological responses (By similarity).By similarity

Protein-protein interaction databases

BioGridi108364. 27 interactors.
IntActiP54760. 8 interactors.
STRINGi9606.ENSP00000350896.

Chemistry databases

BindingDBiP54760.

Structurei

Secondary structure

1987
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi17 – 22Combined sources6
Helixi23 – 25Combined sources3
Beta strandi33 – 36Combined sources4
Beta strandi43 – 48Combined sources6
Beta strandi54 – 61Combined sources8
Beta strandi63 – 65Combined sources3
Beta strandi70 – 74Combined sources5
Beta strandi84 – 95Combined sources12
Helixi97 – 99Combined sources3
Beta strandi109 – 121Combined sources13
Beta strandi130 – 132Combined sources3
Beta strandi135 – 142Combined sources8
Beta strandi147 – 150Combined sources4
Turni151 – 153Combined sources3
Beta strandi154 – 156Combined sources3
Beta strandi160 – 166Combined sources7
Beta strandi171 – 182Combined sources12
Beta strandi184 – 196Combined sources13
Beta strandi441 – 446Combined sources6
Beta strandi449 – 453Combined sources5
Beta strandi460 – 462Combined sources3
Beta strandi466 – 473Combined sources8
Turni479 – 481Combined sources3
Beta strandi482 – 496Combined sources15
Beta strandi503 – 510Combined sources8
Helixi612 – 614Combined sources3
Beta strandi615 – 623Combined sources9
Beta strandi625 – 634Combined sources10
Beta strandi637 – 639Combined sources3
Beta strandi642 – 649Combined sources8
Helixi655 – 668Combined sources14
Beta strandi679 – 683Combined sources5
Beta strandi685 – 694Combined sources10
Helixi701 – 707Combined sources7
Turni708 – 710Combined sources3
Helixi714 – 733Combined sources20
Helixi743 – 745Combined sources3
Beta strandi746 – 748Combined sources3
Beta strandi754 – 756Combined sources3
Helixi765 – 767Combined sources3
Helixi784 – 786Combined sources3
Helixi789 – 794Combined sources6
Helixi799 – 814Combined sources16
Turni815 – 817Combined sources3
Turni820 – 823Combined sources4
Helixi826 – 834Combined sources9
Helixi847 – 856Combined sources10
Helixi861 – 863Combined sources3
Helixi867 – 879Combined sources13
Helixi881 – 885Combined sources5
Helixi912 – 918Combined sources7
Helixi922 – 924Combined sources3
Helixi925 – 930Combined sources6
Helixi936 – 939Combined sources4
Helixi944 – 950Combined sources7
Helixi955 – 965Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2BBAX-ray1.65A17-196[»]
2E7HNMR-A434-529[»]
2HLEX-ray2.05A17-196[»]
2QKQX-ray2.10A/B896-977[»]
2VWUX-ray2.00A598-887[»]
2VWVX-ray1.90A598-899[»]
2VWWX-ray1.90A598-899[»]
2VWXX-ray1.65A598-899[»]
2VWYX-ray1.65A598-899[»]
2VWZX-ray1.65A598-899[»]
2VX0X-ray2.10A598-899[»]
2VX1X-ray1.65A598-899[»]
2X9FX-ray1.75A598-899[»]
2XVDX-ray1.70A598-899[»]
2YN8X-ray2.11A/B598-892[»]
3ZEWX-ray2.50A/B598-892[»]
4AW5X-ray2.33A605-890[»]
4BB4X-ray1.65A598-899[»]
ProteinModelPortaliP54760.
SMRiP54760.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP54760.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini17 – 202Eph LBDPROSITE-ProRule annotationAdd BLAST186
Domaini323 – 432Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST110
Domaini436 – 529Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST94
Domaini615 – 899Protein kinasePROSITE-ProRule annotationAdd BLAST285
Domaini907 – 971SAMPROSITE-ProRule annotationAdd BLAST65

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi985 – 987PDZ-bindingSequence analysis3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi184 – 320Cys-richAdd BLAST137

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.PROSITE-ProRule annotation
Contains 1 Eph LBD (Eph ligand-binding) domain.PROSITE-ProRule annotation
Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation
Contains 1 SAM (sterile alpha motif) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0196. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00760000118975.
HOGENOMiHOG000233856.
HOVERGENiHBG062180.
InParanoidiP54760.
KOiK05113.
OMAiTVFYFES.
OrthoDBiEOG091G00W0.
PhylomeDBiP54760.
TreeFamiTF315608.

Family and domain databases

CDDicd00063. FN3. 2 hits.
Gene3Di1.10.150.50. 1 hit.
2.60.120.260. 1 hit.
2.60.40.10. 2 hits.
InterProiIPR027936. Eph_TM.
IPR001090. Ephrin_rcpt_lig-bd_dom.
IPR003961. FN3_dom.
IPR008979. Galactose-bd-like.
IPR009030. Growth_fac_rcpt_.
IPR013783. Ig-like_fold.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR011641. Tyr-kin_ephrin_A/B_rcpt-like.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR016257. Tyr_kinase_ephrin_rcpt.
IPR001426. Tyr_kinase_rcpt_V_CS.
[Graphical view]
PfamiPF14575. EphA2_TM. 1 hit.
PF01404. Ephrin_lbd. 1 hit.
PF07699. Ephrin_rec_like. 1 hit.
PF00041. fn3. 2 hits.
PF07714. Pkinase_Tyr. 1 hit.
PF00536. SAM_1. 1 hit.
[Graphical view]
PIRSFiPIRSF000666. TyrPK_ephrin_receptor. 1 hit.
PRINTSiPR00109. TYRKINASE.
SMARTiSM00615. EPH_lbd. 1 hit.
SM01411. Ephrin_rec_like. 1 hit.
SM00060. FN3. 2 hits.
SM00454. SAM. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
SSF49265. SSF49265. 1 hit.
SSF49785. SSF49785. 1 hit.
SSF56112. SSF56112. 1 hit.
SSF57184. SSF57184. 2 hits.
PROSITEiPS01186. EGF_2. 1 hit.
PS51550. EPH_LBD. 1 hit.
PS50853. FN3. 2 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00790. RECEPTOR_TYR_KIN_V_1. 1 hit.
PS00791. RECEPTOR_TYR_KIN_V_2. 1 hit.
PS50105. SAM_DOMAIN. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P54760-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELRVLLCWA SLAAALEETL LNTKLETADL KWVTFPQVDG QWEELSGLDE
60 70 80 90 100
EQHSVRTYEV CDVQRAPGQA HWLRTGWVPR RGAVHVYATL RFTMLECLSL
110 120 130 140 150
PRAGRSCKET FTVFYYESDA DTATALTPAW MENPYIKVDT VAAEHLTRKR
160 170 180 190 200
PGAEATGKVN VKTLRLGPLS KAGFYLAFQD QGACMALLSL HLFYKKCAQL
210 220 230 240 250
TVNLTRFPET VPRELVVPVA GSCVVDAVPA PGPSPSLYCR EDGQWAEQPV
260 270 280 290 300
TGCSCAPGFE AAEGNTKCRA CAQGTFKPLS GEGSCQPCPA NSHSNTIGSA
310 320 330 340 350
VCQCRVGYFR ARTDPRGAPC TTPPSAPRSV VSRLNGSSLH LEWSAPLESG
360 370 380 390 400
GREDLTYALR CRECRPGGSC APCGGDLTFD PGPRDLVEPW VVVRGLRPDF
410 420 430 440 450
TYTFEVTALN GVSSLATGPV PFEPVNVTTD REVPPAVSDI RVTRSSPSSL
460 470 480 490 500
SLAWAVPRAP SGAVLDYEVK YHEKGAEGPS SVRFLKTSEN RAELRGLKRG
510 520 530 540 550
ASYLVQVRAR SEAGYGPFGQ EHHSQTQLDE SEGWREQLAL IAGTAVVGVV
560 570 580 590 600
LVLVVIVVAV LCLRKQSNGR EAEYSDKHGQ YLIGHGTKVY IDPFTYEDPN
610 620 630 640 650
EAVREFAKEI DVSYVKIEEV IGAGEFGEVC RGRLKAPGKK ESCVAIKTLK
660 670 680 690 700
GGYTERQRRE FLSEASIMGQ FEHPNIIRLE GVVTNSMPVM ILTEFMENGA
710 720 730 740 750
LDSFLRLNDG QFTVIQLVGM LRGIASGMRY LAEMSYVHRD LAARNILVNS
760 770 780 790 800
NLVCKVSDFG LSRFLEENSS DPTYTSSLGG KIPIRWTAPE AIAFRKFTSA
810 820 830 840 850
SDAWSYGIVM WEVMSFGERP YWDMSNQDVI NAIEQDYRLP PPPDCPTSLH
860 870 880 890 900
QLMLDCWQKD RNARPRFPQV VSALDKMIRN PASLKIVARE NGGASHPLLD
910 920 930 940 950
QRQPHYSAFG SVGEWLRAIK MGRYEESFAA AGFGSFELVS QISAEDLLRI
960 970 980
GVTLAGHQKK ILASVQHMKS QAKPGTPGGT GGPAPQY
Length:987
Mass (Da):108,270
Last modified:October 18, 2001 - v2
Checksum:i11A004622F194706
GO
Isoform 2 (identifier: P54760-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     507-516: VRARSEAGYG → RARAGGSSWP
     517-987: Missing.

Show »
Length:516
Mass (Da):55,975
Checksum:i076696B61467596C
GO
Isoform 3 (identifier: P54760-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     270-306: ACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRV → GRRGSQQRAVPEDVRKPGRAAGAEAGSQLPGAGTGAL
     307-987: Missing.

Show »
Length:306
Mass (Da):33,342
Checksum:iAAAB50A132494B86
GO
Isoform 4 (identifier: P54760-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     406-414: VTALNGVSS → YLLQCLTSG
     415-987: Missing.

Show »
Length:414
Mass (Da):45,195
Checksum:iA9596D1E38B18785
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti62D → E in AAA20598 (PubMed:8188704).Curated1
Sequence conflicti308Y → D in AAA20598 (PubMed:8188704).Curated1
Sequence conflicti464V → W in AAA20598 (PubMed:8188704).Curated1
Sequence conflicti926 – 927ES → AR in AAA20598 (PubMed:8188704).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04218167P → L.1 PublicationCorresponds to variant rs34653459dbSNPEnsembl.1
Natural variantiVAR_042182113V → I.1 PublicationCorresponds to variant rs55866373dbSNPEnsembl.1
Natural variantiVAR_071163162K → R.1 PublicationCorresponds to variant rs17854760dbSNPEnsembl.1
Natural variantiVAR_042183346P → L in a metastatic melanoma sample; somatic mutation. 1 PublicationCorresponds to variant rs267601191dbSNPEnsembl.1
Natural variantiVAR_042184371A → V.1 PublicationCorresponds to variant rs55720981dbSNPEnsembl.1
Natural variantiVAR_042185576D → E.1 PublicationCorresponds to variant rs36050247dbSNPEnsembl.1
Natural variantiVAR_042186678R → H.1 PublicationCorresponds to variant rs55692440dbSNPEnsembl.1
Natural variantiVAR_042187882A → T.1 PublicationCorresponds to variant rs34918225dbSNPEnsembl.1
Natural variantiVAR_042188889R → W in a gastric adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant rs762016655dbSNPEnsembl.1
Natural variantiVAR_042189890E → D.1 PublicationCorresponds to variant rs35638378dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056020270 – 306ACAQG…CQCRV → GRRGSQQRAVPEDVRKPGRA AGAEAGSQLPGAGTGAL in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_056021307 – 987Missing in isoform 3. 1 PublicationAdd BLAST681
Alternative sequenceiVSP_056022406 – 414VTALNGVSS → YLLQCLTSG in isoform 4. 1 Publication9
Alternative sequenceiVSP_056023415 – 987Missing in isoform 4. 1 PublicationAdd BLAST573
Alternative sequenceiVSP_056024507 – 516VRARSEAGYG → RARAGGSSWP in isoform 2. 1 Publication10
Alternative sequenceiVSP_056025517 – 987Missing in isoform 2. 1 PublicationAdd BLAST471

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U07695 mRNA. Translation: AAA20598.1.
AF312032 Genomic DNA. Translation: AAK21010.1.
EU826608 mRNA. Translation: ACF47644.1.
EU826609 mRNA. Translation: ACF47645.1.
EU826610 mRNA. Translation: ACF47646.1.
BC004264 mRNA. Translation: AAH04264.1.
BC052804 mRNA. Translation: AAH52804.1.
CCDSiCCDS5706.1. [P54760-1]
PIRiA54092.
RefSeqiNP_004435.3. NM_004444.4. [P54760-1]
UniGeneiHs.437008.

Genome annotation databases

EnsembliENST00000358173; ENSP00000350896; ENSG00000196411. [P54760-1]
ENST00000616502; ENSP00000482702; ENSG00000196411. [P54760-3]
GeneIDi2050.
KEGGihsa:2050.
UCSCiuc011kkg.2. human. [P54760-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U07695 mRNA. Translation: AAA20598.1.
AF312032 Genomic DNA. Translation: AAK21010.1.
EU826608 mRNA. Translation: ACF47644.1.
EU826609 mRNA. Translation: ACF47645.1.
EU826610 mRNA. Translation: ACF47646.1.
BC004264 mRNA. Translation: AAH04264.1.
BC052804 mRNA. Translation: AAH52804.1.
CCDSiCCDS5706.1. [P54760-1]
PIRiA54092.
RefSeqiNP_004435.3. NM_004444.4. [P54760-1]
UniGeneiHs.437008.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2BBAX-ray1.65A17-196[»]
2E7HNMR-A434-529[»]
2HLEX-ray2.05A17-196[»]
2QKQX-ray2.10A/B896-977[»]
2VWUX-ray2.00A598-887[»]
2VWVX-ray1.90A598-899[»]
2VWWX-ray1.90A598-899[»]
2VWXX-ray1.65A598-899[»]
2VWYX-ray1.65A598-899[»]
2VWZX-ray1.65A598-899[»]
2VX0X-ray2.10A598-899[»]
2VX1X-ray1.65A598-899[»]
2X9FX-ray1.75A598-899[»]
2XVDX-ray1.70A598-899[»]
2YN8X-ray2.11A/B598-892[»]
3ZEWX-ray2.50A/B598-892[»]
4AW5X-ray2.33A605-890[»]
4BB4X-ray1.65A598-899[»]
ProteinModelPortaliP54760.
SMRiP54760.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108364. 27 interactors.
IntActiP54760. 8 interactors.
STRINGi9606.ENSP00000350896.

Chemistry databases

BindingDBiP54760.
ChEMBLiCHEMBL5147.
GuidetoPHARMACOLOGYi1833.

PTM databases

iPTMnetiP54760.
PhosphoSitePlusiP54760.
SwissPalmiP54760.

Polymorphism and mutation databases

BioMutaiEPHB4.
DMDMi19860819.

2D gel databases

DOSAC-COBS-2DPAGEP54760.

Proteomic databases

EPDiP54760.
PaxDbiP54760.
PeptideAtlasiP54760.
PRIDEiP54760.

Protocols and materials databases

DNASUi2050.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358173; ENSP00000350896; ENSG00000196411. [P54760-1]
ENST00000616502; ENSP00000482702; ENSG00000196411. [P54760-3]
GeneIDi2050.
KEGGihsa:2050.
UCSCiuc011kkg.2. human. [P54760-1]

Organism-specific databases

CTDi2050.
DisGeNETi2050.
GeneCardsiEPHB4.
H-InvDBHIX0025312.
HGNCiHGNC:3395. EPHB4.
HPAiCAB013537.
MIMi600011. gene.
neXtProtiNX_P54760.
OpenTargetsiENSG00000196411.
PharmGKBiPA27827.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0196. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00760000118975.
HOGENOMiHOG000233856.
HOVERGENiHBG062180.
InParanoidiP54760.
KOiK05113.
OMAiTVFYFES.
OrthoDBiEOG091G00W0.
PhylomeDBiP54760.
TreeFamiTF315608.

Enzyme and pathway databases

BioCyciZFISH:HS02886-MONOMER.
BRENDAi2.7.10.1. 2681.
ReactomeiR-HSA-2682334. EPH-Ephrin signaling.
R-HSA-3928662. EPHB-mediated forward signaling.
R-HSA-3928664. Ephrin signaling.
R-HSA-3928665. EPH-ephrin mediated repulsion of cells.
SignaLinkiP54760.
SIGNORiP54760.

Miscellaneous databases

ChiTaRSiEPHB4. human.
EvolutionaryTraceiP54760.
GeneWikiiEPH_receptor_B4.
GenomeRNAii2050.
PROiP54760.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000196411.
CleanExiHS_EPHB4.
ExpressionAtlasiP54760. baseline and differential.
GenevisibleiP54760. HS.

Family and domain databases

CDDicd00063. FN3. 2 hits.
Gene3Di1.10.150.50. 1 hit.
2.60.120.260. 1 hit.
2.60.40.10. 2 hits.
InterProiIPR027936. Eph_TM.
IPR001090. Ephrin_rcpt_lig-bd_dom.
IPR003961. FN3_dom.
IPR008979. Galactose-bd-like.
IPR009030. Growth_fac_rcpt_.
IPR013783. Ig-like_fold.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR011641. Tyr-kin_ephrin_A/B_rcpt-like.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
IPR016257. Tyr_kinase_ephrin_rcpt.
IPR001426. Tyr_kinase_rcpt_V_CS.
[Graphical view]
PfamiPF14575. EphA2_TM. 1 hit.
PF01404. Ephrin_lbd. 1 hit.
PF07699. Ephrin_rec_like. 1 hit.
PF00041. fn3. 2 hits.
PF07714. Pkinase_Tyr. 1 hit.
PF00536. SAM_1. 1 hit.
[Graphical view]
PIRSFiPIRSF000666. TyrPK_ephrin_receptor. 1 hit.
PRINTSiPR00109. TYRKINASE.
SMARTiSM00615. EPH_lbd. 1 hit.
SM01411. Ephrin_rec_like. 1 hit.
SM00060. FN3. 2 hits.
SM00454. SAM. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
SSF49265. SSF49265. 1 hit.
SSF49785. SSF49785. 1 hit.
SSF56112. SSF56112. 1 hit.
SSF57184. SSF57184. 2 hits.
PROSITEiPS01186. EGF_2. 1 hit.
PS51550. EPH_LBD. 1 hit.
PS50853. FN3. 2 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
PS00790. RECEPTOR_TYR_KIN_V_1. 1 hit.
PS00791. RECEPTOR_TYR_KIN_V_2. 1 hit.
PS50105. SAM_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiEPHB4_HUMAN
AccessioniPrimary (citable) accession number: P54760
Secondary accession number(s): B5A970
, B5A971, B5A972, Q7Z635, Q9BTA5, Q9BXP0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 18, 2001
Last modified: November 30, 2016
This is version 188 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.