Reviewed,
UniProtKB/Swiss-Prot P54757 (EPHA5_RAT)
Last modified
October 13, 2009.
Version 95.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Ephrin type-A receptor 5 EC=2.7.10.1 Alternative name(s): Tyrosine-protein kinase receptor EHK-1 EPH homology kinase 1 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 1005 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Receptor for members of the ephrin-A family. Binds to ephrin-A1, -A2, -A3, -A4 and -A5. |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. |
| Subcellular location | |
| Tissue specificity | Almost exclusively expressed in the nervous system. Predominantly expressed in neurons. |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily. Contains 2 fibronectin type-III domains. Contains 1 protein kinase domain. Contains 1 SAM (sterile alpha motif) domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Signal Transmembrane |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Receptor Transferase Tyrosine-protein kinase |
| PTM | Glycoprotein Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | protein amino acid phosphorylation Inferred from electronic annotation. Source: InterPro transmembrane receptor protein tyrosine kinase signaling pathwayInferred from electronic annotation. Source: InterPro |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW ephrin receptor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P54757-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P54757-2) The sequence of this isoform differs from the canonical sequence as follows: 306-357: VCRPGFFKASPHSQTCSKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACT → G | ||||||
| Isoform 3 (identifier: P54757-3) The sequence of this isoform differs from the canonical sequence as follows: 358-470: RPPSAPRNAI...SVNVTTNQAA → T | ||||||
| Note: Ref.2 (CAA55357) sequence differs from that shown due to several frameshifts. | ||||||
| Isoform 4 (identifier: P54757-4) The sequence of this isoform differs from the canonical sequence as follows: 358-470: RPPSAPRNAI...SVNVTTNQAA → T 597-621: SGSCCECGCGRASSLCAVAHPSLIW → R | ||||||
| Isoform 5 (identifier: P54757-5) The sequence of this isoform differs from the canonical sequence as follows: 306-357: VCRPGFFKASPHSQTCSKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACT → G 358-470: RPPSAPRNAI...SVNVTTNQAA → T 597-621: SGSCCECGCGRASSLCAVAHPSLIW → R |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 26 | 26 | By similarity | ||||||
| Chain | 27 – 1005 | 979 | Ephrin type-A receptor 5 | PRO_0000016814 | |||||
Regions | |||||||||
| Topological domain | 27 – 575 | 549 | Extracellular Potential | ||||||
| Transmembrane | 576 – 596 | 21 | Potential | ||||||
| Topological domain | 597 – 1005 | 409 | Cytoplasmic Potential | ||||||
| Domain | 359 – 461 | 103 | Fibronectin type-III 1 | ||||||
| Domain | 471 – 561 | 91 | Fibronectin type-III 2 | ||||||
| Domain | 677 – 938 | 262 | Protein kinase | ||||||
| Domain | 967 – 1005 | 39 | SAM | ||||||
| Nucleotide binding | 683 – 691 | 9 | ATP By similarity | ||||||
| Compositional bias | 222 – 356 | 135 | Cys-rich | ||||||
Sites | |||||||||
| Active site | 802 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 709 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 652 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||
| Modified residue | 658 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||
| Modified residue | 835 | 1 | Phosphotyrosine; by autocatalysis Potential | ||||||
| Modified residue | 984 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||
| Glycosylation | 266 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 301 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 371 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 425 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 438 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 463 | 1 | N-linked (GlcNAc...) Potential | VSP_003000 | |||||
Natural variations | |||||||||
| Alternative sequence | 306 – 357 | 52 | VCRPG…TMACT → G in isoform 2 and isoform 5. | VSP_003001 | |||||
| Alternative sequence | 358 – 470 | 113 | RPPSA…TNQAA → T in isoform 3, isoform 4 and isoform 5. | VSP_003002 | |||||
| Alternative sequence | 597 – 621 | 25 | SGSCC…PSLIW → R in isoform 4 and isoform 5. | VSP_003003 | |||||
Experimental info | |||||||||
| Sequence conflict | 170 | 1 | D → E in CAA55357. Ref.2 | ||||||
| Sequence conflict | 566 | 1 | G → A in CAA55357. Ref.2 | ||||||
| Sequence conflict | 578 | 1 | G → A in CAA55357. Ref.2 | ||||||
| Sequence conflict | 669 | 1 | G → A in CAA55357. Ref.2 | ||||||
| Sequence conflict | 708 | 1 | T → I in CAA55357. Ref.2 | ||||||
| Sequence conflict | 979 | 1 | T → I in CAA55357. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Ehk-1 and Ehk-2: two novel members of the Eph receptor-like tyrosine kinase family with distinctive structures and neuronal expression." Maisonpierre P.C., Barrezueta N.X., Yancopoulos G.D. Oncogene 8:3277-3288(1993) [PubMed: 7504232] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5). Strain: Sprague-Dawley. Tissue: Brain. |
| [2] | "Expression and developmental regulation of Ehk-1, a neuronal Elk-like receptor tyrosine kinase in brain." Taylor V., Miescher G.C., Pfarr S., Honegger P., Breitschopf H., Lassmann H., Steck A.J. Neuroscience 63:163-178(1994) [PubMed: 7898646] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Strain: Sprague-Dawley. Tissue: Brain. |
Cross-references
Sequence databases | |
|---|---|
| X78689 mRNA. Translation: CAA55357.1. Frameshift. | |
| IPI | IPI00188217. IPI00230957. IPI00230958. IPI00230959. IPI00230960. |
| PIR | PT0186. S47489. S49015. S51603. S51604. |
| UniGene | Rn.24569 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1JPA based on UniProtKB P54763. |
| SMR | P54757. Positions 657-951. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P54757. |
PTM databases | |
| PhosphoSite | P54757. |
Proteomic databases | |
| PRIDE | P54757. |
Genome annotation databases | |
| Ensembl | ENSRNOT00000002793; ENSRNOP00000002793; ENSRNOG00000002024; Rattus norvegicus. [Genome view] ENSRNOT00000002798; ENSRNOP00000002798; ENSRNOG00000002024; Rattus norvegicus. [Genome view] ENSRNOT00000042149; ENSRNOP00000047823; ENSRNOG00000002024; Rattus norvegicus. [Genome view] ENSRNOT00000043938; ENSRNOP00000043926; ENSRNOG00000002024; Rattus norvegicus. [Genome view] ENSRNOT00000047290; ENSRNOP00000040977; ENSRNOG00000002024; Rattus norvegicus. [Genome view] |
Organism-specific databases | |
| RGD | 620831. Epha5. |
Phylogenomic databases | |
| HOVERGEN | P54757. |
Enzyme and pathway databases | |
| BRENDA | 2.7.10.1. 248. |
Gene expression databases | |
| ArrayExpress | P54757. |
| Genevestigator | P54757. |
| GermOnline | ENSRNOG00000002024. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR015215. BmKX. IPR013032. EGF-like_reg_CS. IPR001090. Ephrin_rcpt_lig-bd. IPR008957. Fibronectin_typ-III-like_fold. IPR003961. FN_III. IPR003962. FnIII_subd. IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR001660. SAM. IPR013761. SAM_type. IPR001245. Tyr_pkinase. IPR008266. Tyr_pkinase_AS. IPR016257. TyrPK_ephrin_receptor. IPR001426. YKase_receptorV_CS. [Graphical view] |
| Gene3D | G3DSA:2.60.40.30. FN_III-like. 2 hits. G3DSA:1.10.150.50. SAM_type. 1 hit. |
| Pfam | PF09132. BmKX. 1 hit. PF01404. Ephrin_lbd. 1 hit. PF00041. fn3. 2 hits. PF07714. Pkinase_Tyr. 1 hit. PF00536. SAM_1. 1 hit. [Graphical view] |
| PIRSF | PIRSF000666. TyrPK_ephrin_receptor. 1 hit. |
| PRINTS | PR00014. FNTYPEIII. PR00109. TYRKINASE. |
| ProDom | PD001495. Ephrin_receptor. 1 hit. PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00615. EPH_lbd. 1 hit. SM00060. FN3. 2 hits. SM00219. TyrKc. 1 hit. [Graphical view] |
| PROSITE | PS01186. EGF_2. 1 hit. Uncertain. PS50853. FN3. 2 hits. PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. PS00790. RECEPTOR_TYR_KIN_V_1. 1 hit. PS00791. RECEPTOR_TYR_KIN_V_2. 1 hit. PS50105. SAM_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | EPHA5_RAT | ||||||||
| Accession | Primary (citable) accession number: P54757 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||

Clusters with


