Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P54750

- PDE1A_HUMAN

UniProt

P54750 - PDE1A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A

Gene

PDE1A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP.

Catalytic activityi

Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.

Cofactori

Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity.By similarity

Enzyme regulationi

Type I PDE are activated by the binding of calmodulin in the presence of Ca2+.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei219 – 2191Proton donorBy similarity
Metal bindingi223 – 2231Divalent metal cation 1By similarity
Metal bindingi259 – 2591Divalent metal cation 1By similarity
Metal bindingi260 – 2601Divalent metal cation 1By similarity
Metal bindingi260 – 2601Divalent metal cation 2By similarity
Metal bindingi366 – 3661Divalent metal cation 1By similarity

GO - Molecular functioni

  1. 3',5'-cyclic-AMP phosphodiesterase activity Source: Ensembl
  2. calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activity Source: Ensembl
  3. calmodulin-dependent cyclic-nucleotide phosphodiesterase activity Source: ProtInc
  4. cGMP binding Source: Ensembl
  5. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. activation of phospholipase C activity Source: Reactome
  2. blood coagulation Source: Reactome
  3. cAMP catabolic process Source: Ensembl
  4. cGMP catabolic process Source: Ensembl
  5. epidermal growth factor receptor signaling pathway Source: Reactome
  6. fibroblast growth factor receptor signaling pathway Source: Reactome
  7. innate immune response Source: Reactome
  8. neurotrophin TRK receptor signaling pathway Source: Reactome
  9. regulation of smooth muscle cell apoptotic process Source: Ensembl
  10. regulation of smooth muscle cell proliferation Source: Ensembl
  11. signal transduction Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Calmodulin-binding, cAMP, cGMP, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_15408. Cam-PDE 1 activation.
REACT_19327. G alpha (s) signalling events.
REACT_23767. cGMP effects.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A (EC:3.1.4.17)
Short name:
Cam-PDE 1A
Alternative name(s):
61 kDa Cam-PDE
hCam-1
Gene namesi
Name:PDE1A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:8774. PDE1A.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. neuronal cell body Source: Ensembl
  3. nucleus Source: Ensembl
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33122.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 535534Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1APRO_0000198785Add
BLAST

Proteomic databases

MaxQBiP54750.
PaxDbiP54750.
PRIDEiP54750.

PTM databases

PhosphoSiteiP54750.

Expressioni

Tissue specificityi

Several tissues, including brain, kidney, testes and heart.

Gene expression databases

BgeeiP54750.
ExpressionAtlasiP54750. baseline and differential.
GenevestigatoriP54750.

Organism-specific databases

HPAiHPA022151.

Interactioni

Subunit structurei

Homodimer.By similarity

Protein-protein interaction databases

BioGridi111162. 4 interactions.
IntActiP54750. 1 interaction.
MINTiMINT-4717501.

Structurei

Secondary structure

1
535
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni154 – 1574
Helixi163 – 1697
Helixi174 – 18512
Helixi188 – 1914
Helixi196 – 20813
Turni212 – 2143
Beta strandi216 – 2194
Helixi220 – 23314
Helixi237 – 2393
Turni240 – 2423
Helixi245 – 25713
Turni258 – 2614
Helixi267 – 2726
Helixi276 – 2805
Turni281 – 2833
Helixi286 – 29712
Helixi298 – 3003
Turni306 – 3094
Helixi312 – 32716
Helixi331 – 3333
Helixi334 – 34613
Helixi354 – 36512
Helixi368 – 3703
Helixi373 – 39624
Turni407 – 4093
Helixi412 – 42211
Helixi424 – 4307

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1LXQmodel-A154-432[»]
ProteinModelPortaliP54750.
SMRiP54750. Positions 142-520.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni24 – 4421Calmodulin-bindingBy similarityAdd
BLAST
Regioni193 – 515323CatalyticBy similarityAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG139098.
GeneTreeiENSGT00760000118889.
HOVERGENiHBG056120.
KOiK13755.
OMAiQEEEMNV.
OrthoDBiEOG7X9G6J.
PhylomeDBiP54750.
TreeFamiTF314638.

Family and domain databases

Gene3Di1.10.1300.10. 2 hits.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
IPR013706. PDEase_N.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
PF08499. PDEase_I_N. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P54750-1) [UniParc]FASTAAdd to Basket

Also known as: PDE1A3, PDE1A6

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSSATEIEE LENTTFKYLT GEQTEKMWQR LKGILRCLVK QLERGDVNVV
60 70 80 90 100
DLKKNIEYAA SVLEAVYIDE TRRLLDTEDE LSDIQTDSVP SEVRDWLAST
110 120 130 140 150
FTRKMGMTKK KPEEKPKFRS IVHAVQAGIF VERMYRKTYH MVGLAYPAAV
160 170 180 190 200
IVTLKDVDKW SFDVFALNEA SGEHSLKFMI YELFTRYDLI NRFKIPVSCL
210 220 230 240 250
ITFAEALEVG YSKYKNPYHN LIHAADVTQT VHYIMLHTGI MHWLTELEIL
260 270 280 290 300
AMVFAAAIHD YEHTGTTNNF HIQTRSDVAI LYNDRSVLEN HHVSAAYRLM
310 320 330 340 350
QEEEMNILIN LSKDDWRDLR NLVIEMVLST DMSGHFQQIK NIRNSLQQPE
360 370 380 390 400
GIDRAKTMSL ILHAADISHP AKSWKLHYRW TMALMEEFFL QGDKEAELGL
410 420 430 440 450
PFSPLCDRKS TMVAQSQIGF IDFIVEPTFS LLTDSTEKIV IPLIEEASKA
460 470 480 490 500
ETSSYVASSS TTIVGLHIAD ALRRSNTKGS MSDGSYSPDY SLAAVDLKSF
510 520 530
KNNLVDIIQQ NKERWKELAA QEARTSSQKC EFIHQ
Length:535
Mass (Da):61,252
Last modified:January 23, 2007 - v2
Checksum:iB1878145160BB3D7
GO
Isoform 2 (identifier: P54750-2) [UniParc]FASTAAdd to Basket

Also known as: PDE1A4, PDE1A5

The sequence of this isoform differs from the canonical sequence as follows:
     2-34: GSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR

Show »
Length:520
Mass (Da):59,723
Checksum:i8FFD320EF08C01DE
GO
Isoform 3 (identifier: P54750-3) [UniParc]FASTAAdd to Basket

Also known as: PDE1A10

The sequence of this isoform differs from the canonical sequence as follows:
     2-72: GSSATEIEEL...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE

Show »
Length:502
Mass (Da):57,614
Checksum:i14C0823000447A8E
GO
Isoform 4 (identifier: P54750-4) [UniParc]FASTAAdd to Basket

Also known as: PDE1A5

The sequence of this isoform differs from the canonical sequence as follows:
     522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS

Show »
Length:545
Mass (Da):62,309
Checksum:iBE2A280A504FDB9E
GO
Isoform 5 (identifier: P54750-5) [UniParc]FASTAAdd to Basket

Also known as: PDE1A9

The sequence of this isoform differs from the canonical sequence as follows:
     522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL

Show »
Length:552
Mass (Da):63,040
Checksum:i0956259BB3F5E938
GO
Isoform 6 (identifier: P54750-6) [UniParc]FASTAAdd to Basket

Also known as: PDE1A1

The sequence of this isoform differs from the canonical sequence as follows:
     2-34: GSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR
     522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS

Show »
Length:530
Mass (Da):60,780
Checksum:i39DB606547FC0CE2
GO
Isoform 7 (identifier: P54750-7) [UniParc]FASTAAdd to Basket

Also known as: PDE1A8

The sequence of this isoform differs from the canonical sequence as follows:
     2-34: GSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR
     522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL

Show »
Length:537
Mass (Da):61,512
Checksum:i9187F614548EB3FF
GO
Isoform 8 (identifier: P54750-8) [UniParc]FASTAAdd to Basket

Also known as: PDE1A11

The sequence of this isoform differs from the canonical sequence as follows:
     2-72: GSSATEIEEL...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE
     522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS

Show »
Length:512
Mass (Da):58,671
Checksum:i85C9BC1242D9B55B
GO
Isoform 9 (identifier: P54750-9) [UniParc]FASTAAdd to Basket

Also known as: PDE1A12

The sequence of this isoform differs from the canonical sequence as follows:
     2-72: GSSATEIEEL...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE
     522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL

Show »
Length:519
Mass (Da):59,402
Checksum:i8943F30315077A73
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 7271GSSAT…IDETR → MGKKINKLFCFNFLVQCFRG KSKPSKCQIRKKVKNHIE in isoform 3, isoform 8 and isoform 9. 1 PublicationVSP_004548Add
BLAST
Alternative sequencei2 – 3433GSSAT…RLKGI → MDDHVTIRKKHLQRPIFR in isoform 2, isoform 6 and isoform 7. 2 PublicationsVSP_004547Add
BLAST
Alternative sequencei522 – 53514EARTS…EFIHQ → GESDLHKNSEDLVNAEEKHD ETHS in isoform 4, isoform 6 and isoform 8. 1 PublicationVSP_004549Add
BLAST
Alternative sequencei522 – 53514EARTS…EFIHQ → GSVVYEALLPSLSVFTSPLR VWITSSRFLLL in isoform 5, isoform 7 and isoform 9. CuratedVSP_004550Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U40370 mRNA. Translation: AAC50436.1.
AB038224 Genomic DNA. Translation: BAB20049.1.
AB038224 Genomic DNA. Translation: BAB20050.1.
AB038224 Genomic DNA. Translation: BAB20051.1.
AB038224 Genomic DNA. Translation: BAB20052.1.
AB038224 Genomic DNA. Translation: BAB20053.1.
AB038224 Genomic DNA. Translation: BAB20054.1.
AB038224 Genomic DNA. Translation: BAB20055.1.
AB038224 Genomic DNA. Translation: BAB20056.1.
AB038224 Genomic DNA. Translation: BAB20057.1.
AJ401610 mRNA. Translation: CAC82208.1.
AL110263 mRNA. Translation: CAB53703.1.
CH471058 Genomic DNA. Translation: EAX10966.1.
CH471058 Genomic DNA. Translation: EAX10974.1.
BC022480 mRNA. Translation: AAH22480.1.
CCDSiCCDS2285.1. [P54750-4]
CCDS33344.1. [P54750-1]
PIRiT14783.
RefSeqiNP_001003683.1. NM_001003683.2. [P54750-1]
NP_001245242.1. NM_001258313.1.
NP_001245243.1. NM_001258314.1.
NP_005010.2. NM_005019.4. [P54750-4]
XP_005246692.1. XM_005246635.2. [P54750-5]
XP_005246693.1. XM_005246636.1.
XP_005246694.1. XM_005246637.1.
XP_006712637.1. XM_006712574.1. [P54750-5]
XP_006712638.1. XM_006712575.1. [P54750-5]
XP_006712639.1. XM_006712576.1. [P54750-5]
XP_006712640.1. XM_006712577.1. [P54750-5]
XP_006712641.1. XM_006712578.1. [P54750-4]
XP_006712642.1. XM_006712579.1. [P54750-1]
UniGeneiHs.191046.
Hs.742174.

Genome annotation databases

EnsembliENST00000351439; ENSP00000309269; ENSG00000115252.
ENST00000358139; ENSP00000350858; ENSG00000115252.
ENST00000409365; ENSP00000386767; ENSG00000115252.
ENST00000410103; ENSP00000387037; ENSG00000115252. [P54750-1]
ENST00000435564; ENSP00000410309; ENSG00000115252. [P54750-4]
GeneIDi5136.
KEGGihsa:5136.
UCSCiuc002uoq.2. human. [P54750-4]
uc002uor.4. human. [P54750-2]
uc002uos.4. human. [P54750-1]
uc002uou.4. human. [P54750-3]

Polymorphism databases

DMDMi1705942.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U40370 mRNA. Translation: AAC50436.1 .
AB038224 Genomic DNA. Translation: BAB20049.1 .
AB038224 Genomic DNA. Translation: BAB20050.1 .
AB038224 Genomic DNA. Translation: BAB20051.1 .
AB038224 Genomic DNA. Translation: BAB20052.1 .
AB038224 Genomic DNA. Translation: BAB20053.1 .
AB038224 Genomic DNA. Translation: BAB20054.1 .
AB038224 Genomic DNA. Translation: BAB20055.1 .
AB038224 Genomic DNA. Translation: BAB20056.1 .
AB038224 Genomic DNA. Translation: BAB20057.1 .
AJ401610 mRNA. Translation: CAC82208.1 .
AL110263 mRNA. Translation: CAB53703.1 .
CH471058 Genomic DNA. Translation: EAX10966.1 .
CH471058 Genomic DNA. Translation: EAX10974.1 .
BC022480 mRNA. Translation: AAH22480.1 .
CCDSi CCDS2285.1. [P54750-4 ]
CCDS33344.1. [P54750-1 ]
PIRi T14783.
RefSeqi NP_001003683.1. NM_001003683.2. [P54750-1 ]
NP_001245242.1. NM_001258313.1.
NP_001245243.1. NM_001258314.1.
NP_005010.2. NM_005019.4. [P54750-4 ]
XP_005246692.1. XM_005246635.2. [P54750-5 ]
XP_005246693.1. XM_005246636.1.
XP_005246694.1. XM_005246637.1.
XP_006712637.1. XM_006712574.1. [P54750-5 ]
XP_006712638.1. XM_006712575.1. [P54750-5 ]
XP_006712639.1. XM_006712576.1. [P54750-5 ]
XP_006712640.1. XM_006712577.1. [P54750-5 ]
XP_006712641.1. XM_006712578.1. [P54750-4 ]
XP_006712642.1. XM_006712579.1. [P54750-1 ]
UniGenei Hs.191046.
Hs.742174.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1LXQ model - A 154-432 [» ]
ProteinModelPortali P54750.
SMRi P54750. Positions 142-520.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111162. 4 interactions.
IntActi P54750. 1 interaction.
MINTi MINT-4717501.

Chemistry

BindingDBi P54750.
ChEMBLi CHEMBL2363066.
DrugBanki DB01244. Bepridil.
DB00201. Caffeine.
DB01023. Felodipine.
DB00622. Nicardipine.
GuidetoPHARMACOLOGYi 1294.

PTM databases

PhosphoSitei P54750.

Polymorphism databases

DMDMi 1705942.

Proteomic databases

MaxQBi P54750.
PaxDbi P54750.
PRIDEi P54750.

Protocols and materials databases

DNASUi 5136.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000351439 ; ENSP00000309269 ; ENSG00000115252 .
ENST00000358139 ; ENSP00000350858 ; ENSG00000115252 .
ENST00000409365 ; ENSP00000386767 ; ENSG00000115252 .
ENST00000410103 ; ENSP00000387037 ; ENSG00000115252 . [P54750-1 ]
ENST00000435564 ; ENSP00000410309 ; ENSG00000115252 . [P54750-4 ]
GeneIDi 5136.
KEGGi hsa:5136.
UCSCi uc002uoq.2. human. [P54750-4 ]
uc002uor.4. human. [P54750-2 ]
uc002uos.4. human. [P54750-1 ]
uc002uou.4. human. [P54750-3 ]

Organism-specific databases

CTDi 5136.
GeneCardsi GC02M182971.
HGNCi HGNC:8774. PDE1A.
HPAi HPA022151.
MIMi 171890. gene.
neXtProti NX_P54750.
PharmGKBi PA33122.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG139098.
GeneTreei ENSGT00760000118889.
HOVERGENi HBG056120.
KOi K13755.
OMAi QEEEMNV.
OrthoDBi EOG7X9G6J.
PhylomeDBi P54750.
TreeFami TF314638.

Enzyme and pathway databases

Reactomei REACT_15408. Cam-PDE 1 activation.
REACT_19327. G alpha (s) signalling events.
REACT_23767. cGMP effects.

Miscellaneous databases

ChiTaRSi PDE1A. human.
GeneWikii PDE1A.
GenomeRNAii 5136.
NextBioi 19802.
PROi P54750.
SOURCEi Search...

Gene expression databases

Bgeei P54750.
ExpressionAtlasi P54750. baseline and differential.
Genevestigatori P54750.

Family and domain databases

Gene3Di 1.10.1300.10. 2 hits.
InterProi IPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
IPR013706. PDEase_N.
[Graphical view ]
Pfami PF00233. PDEase_I. 1 hit.
PF08499. PDEase_I_N. 1 hit.
[Graphical view ]
PRINTSi PR00387. PDIESTERASE1.
SMARTi SM00471. HDc. 1 hit.
[Graphical view ]
PROSITEi PS00126. PDEASE_I. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases."
    Loughney K., Martins T.J., Harris E.A.S., Sadhu K., Hicks J.B., Sonnenburg W.K., Beavo J.A., Ferguson K.
    J. Biol. Chem. 271:796-806(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Human Ca2+/calmodulin-dependent phosphodiesterase PDE1A: novel splice variants, their specific expression, genomic organization, and chromosomal localization."
    Michibata H., Yanaka N., Kanoh Y., Okumura K., Omori K.
    Biochim. Biophys. Acta 1517:278-287(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8 AND 9).
    Tissue: Heart.
  3. "Isolation and differential tissue distribution of two human cDNAs encoding PDE1 splice variants."
    Fidock M.D., Miller M., Lanfear J.
    Cell. Signal. 14:53-60(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Uterus.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Brain.

Entry informationi

Entry nameiPDE1A_HUMAN
AccessioniPrimary (citable) accession number: P54750
Secondary accession number(s): D3DPG5
, Q86VZ0, Q9C0K8, Q9C0K9, Q9C0L0, Q9C0L1, Q9C0L2, Q9C0L3, Q9C0L4, Q9UFX3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 23, 2007
Last modified: October 29, 2014
This is version 151 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3