Reviewed,
UniProtKB/Swiss-Prot P54750 (PDE1A_HUMAN)
Last modified
November 3, 2009.
Version 101.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A Short name=Cam-PDE 1A EC=3.1.4.17 Alternative name(s): 61 kDa Cam-PDE Short name=hCam-1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 535 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Has a higher affinity for cGMP than for cAMP. |
| Catalytic activity | Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate. |
| Enzyme regulation | Type I PDE are activated by the binding of calmodulin in the presence of Ca2+. |
| Subunit structure | Homodimer By similarity. |
| Tissue specificity | Several tissues, including brain, kidney, testes and heart. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Calmodulin-binding cAMP cGMP |
| Molecular function | Hydrolase |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | signal transduction Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytosol Inferred from Experiment. Source: Reactome |
| Molecular function | calmodulin binding Inferred from electronic annotation. Source: UniProtKB-KW calmodulin-dependent cyclic-nucleotide phosphodiesterase activity Ref.1Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P54750-1) Also known as: PDE1A3; PDE1A6; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P54750-2) Also known as: PDE1A4; PDE1A5; The sequence of this isoform differs from the canonical sequence as follows: 1-34: MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR | ||||||
| Isoform 3 (identifier: P54750-3) Also known as: PDE1A10; The sequence of this isoform differs from the canonical sequence as follows: 1-72: MGSSATEIEE...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE | ||||||
| Isoform 4 (identifier: P54750-4) Also known as: PDE1A5; The sequence of this isoform differs from the canonical sequence as follows: 522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS | ||||||
| Isoform 5 (identifier: P54750-5) Also known as: PDE1A9; The sequence of this isoform differs from the canonical sequence as follows: 522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL | ||||||
| Isoform 6 (identifier: P54750-6) Also known as: PDE1A1; The sequence of this isoform differs from the canonical sequence as follows: 1-34: MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR 522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS | ||||||
| Isoform 7 (identifier: P54750-7) Also known as: PDE1A8; The sequence of this isoform differs from the canonical sequence as follows: 1-34: MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR 522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL | ||||||
| Isoform 8 (identifier: P54750-8) Also known as: PDE1A11; The sequence of this isoform differs from the canonical sequence as follows: 1-72: MGSSATEIEE...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE 522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS | ||||||
| Isoform 9 (identifier: P54750-9) Also known as: PDE1A12; The sequence of this isoform differs from the canonical sequence as follows: 1-72: MGSSATEIEE...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE 522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 535 | 534 | Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A | PRO_0000198785 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 24 – 44 | 21 | Calmodulin-binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 193 – 515 | 323 | Catalytic By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 72 | 72 | MGSSA…IDETR → MGKKINKLFCFNFLVQCFRG KSKPSKCQIRKKVKNHIE in isoform 3, isoform 8 and isoform 9. | VSP_004548 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 34 | 34 | MGSSA…RLKGI → MDDHVTIRKKHLQRPIFR in isoform 2, isoform 6 and isoform 7. | VSP_004547 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 522 – 535 | 14 | EARTS…EFIHQ → GESDLHKNSEDLVNAEEKHD ETHS in isoform 4, isoform 6 and isoform 8. | VSP_004549 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 522 – 535 | 14 | EARTS…EFIHQ → GSVVYEALLPSLSVFTSPLR VWITSSRFLLL in isoform 5, isoform 7 and isoform 9. | VSP_004550 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 154 – 157 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 163 – 169 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 174 – 185 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 188 – 191 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 196 – 208 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 212 – 214 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 216 – 219 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 220 – 233 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 237 – 239 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 240 – 242 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 245 – 257 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 258 – 261 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 267 – 272 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 276 – 280 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 281 – 283 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 286 – 297 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 298 – 300 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 306 – 309 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 312 – 327 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 331 – 333 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 334 – 346 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 354 – 365 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 368 – 370 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 373 – 396 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 407 – 409 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 412 – 422 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 424 – 430 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases." Loughney K., Martins T.J., Harris E.A.S., Sadhu K., Hicks J.B., Sonnenburg W.K., Beavo J.A., Ferguson K. J. Biol. Chem. 271:796-806(1996) [PubMed: 8557689] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Human Ca2+/calmodulin-dependent phosphodiesterase PDE1A: novel splice variants, their specific expression, genomic organization, and chromosomal localization." Michibata H., Yanaka N., Kanoh Y., Okumura K., Omori K. Biochim. Biophys. Acta 1517:278-287(2001) [PubMed: 11342109] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8 AND 9). Tissue: Heart. |
| [3] | "Isolation and differential tissue distribution of two human cDNAs encoding PDE1 splice variants." Fidock M.D., Miller M., Lanfear J. Cell. Signal. 14:53-60(2002) [PubMed: 11747989] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Uterus. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U40370 mRNA. Translation: AAC50436.1. AB038224 Genomic DNA. Translation: BAB20049.1. AB038224 Genomic DNA. Translation: BAB20050.1. AB038224 Genomic DNA. Translation: BAB20051.1. AB038224 Genomic DNA. Translation: BAB20052.1. AB038224 Genomic DNA. Translation: BAB20053.1. AB038224 Genomic DNA. Translation: BAB20054.1. AB038224 Genomic DNA. Translation: BAB20055.1. AB038224 Genomic DNA. Translation: BAB20056.1. AB038224 Genomic DNA. Translation: BAB20057.1. AJ401610 mRNA. Translation: CAC82208.1. AL110263 mRNA. Translation: CAB53703.1. BC022480 mRNA. Translation: AAH22480.1. | |||||||||||||
| IPI | IPI00008282. IPI00171816. IPI00221139. IPI00221140. IPI00335536. IPI00377231. IPI00395021. IPI00395024. IPI00399272. | ||||||||||||
| PIR | T14783. | ||||||||||||
| RefSeq | NP_001003683.1. NP_005010.2. | ||||||||||||
| UniGene | Hs.191046 Hs.680373 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| SMR | P54750. Positions 142-471. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | P54750. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P54750. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P54750. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000331935; ENSP00000331574; ENSG00000115252; Homo sapiens. [Genome view] ENST00000346717; ENSP00000329112; ENSG00000115252; Homo sapiens. [Genome view] ENST00000351439; ENSP00000309269; ENSG00000115252; Homo sapiens. [Genome view] ENST00000358139; ENSP00000350858; ENSG00000115252; Homo sapiens. [Genome view] ENST00000409365; ENSP00000386767; ENSG00000115252; Homo sapiens. [Genome view] ENST00000410103; ENSP00000387037; ENSG00000115252; Homo sapiens. [Genome view] ENST00000435564; ENSP00000410309; ENSG00000115252; Homo sapiens. [Genome view] ENST00000456212; ENSP00000408874; ENSG00000115252; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 5136. | ||||||||||||
| KEGG | hsa:5136. | ||||||||||||
| UCSC | uc002uoq.1. human. uc002uor.1. human. uc002uos.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5136. | ||||||||||||
| GeneCards | GC02M182715. | ||||||||||||
| H-InvDB | HIX0002648. | ||||||||||||
| HGNC | HGNC:8774. PDE1A. | ||||||||||||
| HPA | HPA022151. | ||||||||||||
| MIM | 171890. gene. | ||||||||||||
| PharmGKB | PA33122. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | P54750. | ||||||||||||
| OMA | LENTTFK. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 3.1.4.17. 247. | ||||||||||||
| Reactome | REACT_11061. Signalling by NGF. REACT_14797. Signaling by GPCR. REACT_15295. Opioid Signalling. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P54750. | ||||||||||||
| Bgee | P54750. | ||||||||||||
| Genevestigator | P54750. | ||||||||||||
| GermOnline | ENSG00000115252. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR003607. Met-dep_phosphohydro_HD. IPR002073. PDEase. IPR013706. PDEase_N. [Graphical view] | ||||||||||||
| Pfam | PF00233. PDEase_I. 1 hit. PF08499. PDEase_I_N. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00387. PDIESTERASE1. | ||||||||||||
| SMART | SM00471. HDc. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 19802. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PDE1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P54750 Secondary accession number(s): Q86VZ0 Q9UFX3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


