Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P54750

- PDE1A_HUMAN

UniProt

P54750 - PDE1A_HUMAN

Protein

Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A

Gene

PDE1A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 150 (01 Oct 2014)
      Sequence version 2 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP.

    Catalytic activityi

    Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.

    Cofactori

    Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity.By similarity

    Enzyme regulationi

    Type I PDE are activated by the binding of calmodulin in the presence of Ca2+.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei219 – 2191Proton donorBy similarity
    Metal bindingi223 – 2231Divalent metal cation 1By similarity
    Metal bindingi259 – 2591Divalent metal cation 1By similarity
    Metal bindingi260 – 2601Divalent metal cation 1By similarity
    Metal bindingi260 – 2601Divalent metal cation 2By similarity
    Metal bindingi366 – 3661Divalent metal cation 1By similarity

    GO - Molecular functioni

    1. 3',5'-cyclic-AMP phosphodiesterase activity Source: Ensembl
    2. calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activity Source: Ensembl
    3. calmodulin-dependent cyclic-nucleotide phosphodiesterase activity Source: ProtInc
    4. cGMP binding Source: Ensembl
    5. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. activation of phospholipase C activity Source: Reactome
    2. blood coagulation Source: Reactome
    3. cAMP catabolic process Source: Ensembl
    4. cGMP catabolic process Source: Ensembl
    5. epidermal growth factor receptor signaling pathway Source: Reactome
    6. fibroblast growth factor receptor signaling pathway Source: Reactome
    7. innate immune response Source: Reactome
    8. neurotrophin TRK receptor signaling pathway Source: Reactome
    9. regulation of smooth muscle cell apoptotic process Source: Ensembl
    10. regulation of smooth muscle cell proliferation Source: Ensembl
    11. signal transduction Source: Reactome

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    Calmodulin-binding, cAMP, cGMP, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_15408. Cam-PDE 1 activation.
    REACT_19327. G alpha (s) signalling events.
    REACT_23767. cGMP effects.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A (EC:3.1.4.17)
    Short name:
    Cam-PDE 1A
    Alternative name(s):
    61 kDa Cam-PDE
    hCam-1
    Gene namesi
    Name:PDE1A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:8774. PDE1A.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. neuronal cell body Source: Ensembl
    3. nucleus Source: Ensembl

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33122.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 535534Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1APRO_0000198785Add
    BLAST

    Proteomic databases

    MaxQBiP54750.
    PaxDbiP54750.
    PRIDEiP54750.

    PTM databases

    PhosphoSiteiP54750.

    Expressioni

    Tissue specificityi

    Several tissues, including brain, kidney, testes and heart.

    Gene expression databases

    ArrayExpressiP54750.
    BgeeiP54750.
    GenevestigatoriP54750.

    Organism-specific databases

    HPAiHPA022151.

    Interactioni

    Subunit structurei

    Homodimer.By similarity

    Protein-protein interaction databases

    BioGridi111162. 4 interactions.
    IntActiP54750. 1 interaction.
    MINTiMINT-4717501.

    Structurei

    Secondary structure

    1
    535
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni154 – 1574
    Helixi163 – 1697
    Helixi174 – 18512
    Helixi188 – 1914
    Helixi196 – 20813
    Turni212 – 2143
    Beta strandi216 – 2194
    Helixi220 – 23314
    Helixi237 – 2393
    Turni240 – 2423
    Helixi245 – 25713
    Turni258 – 2614
    Helixi267 – 2726
    Helixi276 – 2805
    Turni281 – 2833
    Helixi286 – 29712
    Helixi298 – 3003
    Turni306 – 3094
    Helixi312 – 32716
    Helixi331 – 3333
    Helixi334 – 34613
    Helixi354 – 36512
    Helixi368 – 3703
    Helixi373 – 39624
    Turni407 – 4093
    Helixi412 – 42211
    Helixi424 – 4307

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1LXQmodel-A154-432[»]
    ProteinModelPortaliP54750.
    SMRiP54750. Positions 142-520.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni24 – 4421Calmodulin-bindingBy similarityAdd
    BLAST
    Regioni193 – 515323CatalyticBy similarityAdd
    BLAST

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG139098.
    HOVERGENiHBG056120.
    KOiK13755.
    OMAiQEEEMNV.
    OrthoDBiEOG7X9G6J.
    PhylomeDBiP54750.
    TreeFamiTF314638.

    Family and domain databases

    Gene3Di1.10.1300.10. 2 hits.
    InterProiIPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    IPR013706. PDEase_N.
    [Graphical view]
    PfamiPF00233. PDEase_I. 1 hit.
    PF08499. PDEase_I_N. 1 hit.
    [Graphical view]
    PRINTSiPR00387. PDIESTERASE1.
    SMARTiSM00471. HDc. 1 hit.
    [Graphical view]
    PROSITEiPS00126. PDEASE_I. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P54750-1) [UniParc]FASTAAdd to Basket

    Also known as: PDE1A3, PDE1A6

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSSATEIEE LENTTFKYLT GEQTEKMWQR LKGILRCLVK QLERGDVNVV    50
    DLKKNIEYAA SVLEAVYIDE TRRLLDTEDE LSDIQTDSVP SEVRDWLAST 100
    FTRKMGMTKK KPEEKPKFRS IVHAVQAGIF VERMYRKTYH MVGLAYPAAV 150
    IVTLKDVDKW SFDVFALNEA SGEHSLKFMI YELFTRYDLI NRFKIPVSCL 200
    ITFAEALEVG YSKYKNPYHN LIHAADVTQT VHYIMLHTGI MHWLTELEIL 250
    AMVFAAAIHD YEHTGTTNNF HIQTRSDVAI LYNDRSVLEN HHVSAAYRLM 300
    QEEEMNILIN LSKDDWRDLR NLVIEMVLST DMSGHFQQIK NIRNSLQQPE 350
    GIDRAKTMSL ILHAADISHP AKSWKLHYRW TMALMEEFFL QGDKEAELGL 400
    PFSPLCDRKS TMVAQSQIGF IDFIVEPTFS LLTDSTEKIV IPLIEEASKA 450
    ETSSYVASSS TTIVGLHIAD ALRRSNTKGS MSDGSYSPDY SLAAVDLKSF 500
    KNNLVDIIQQ NKERWKELAA QEARTSSQKC EFIHQ 535
    Length:535
    Mass (Da):61,252
    Last modified:January 23, 2007 - v2
    Checksum:iB1878145160BB3D7
    GO
    Isoform 2 (identifier: P54750-2) [UniParc]FASTAAdd to Basket

    Also known as: PDE1A4, PDE1A5

    The sequence of this isoform differs from the canonical sequence as follows:
         2-34: GSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR

    Show »
    Length:520
    Mass (Da):59,723
    Checksum:i8FFD320EF08C01DE
    GO
    Isoform 3 (identifier: P54750-3) [UniParc]FASTAAdd to Basket

    Also known as: PDE1A10

    The sequence of this isoform differs from the canonical sequence as follows:
         2-72: GSSATEIEEL...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE

    Show »
    Length:502
    Mass (Da):57,614
    Checksum:i14C0823000447A8E
    GO
    Isoform 4 (identifier: P54750-4) [UniParc]FASTAAdd to Basket

    Also known as: PDE1A5

    The sequence of this isoform differs from the canonical sequence as follows:
         522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS

    Show »
    Length:545
    Mass (Da):62,309
    Checksum:iBE2A280A504FDB9E
    GO
    Isoform 5 (identifier: P54750-5) [UniParc]FASTAAdd to Basket

    Also known as: PDE1A9

    The sequence of this isoform differs from the canonical sequence as follows:
         522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL

    Show »
    Length:552
    Mass (Da):63,040
    Checksum:i0956259BB3F5E938
    GO
    Isoform 6 (identifier: P54750-6) [UniParc]FASTAAdd to Basket

    Also known as: PDE1A1

    The sequence of this isoform differs from the canonical sequence as follows:
         2-34: GSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR
         522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS

    Show »
    Length:530
    Mass (Da):60,780
    Checksum:i39DB606547FC0CE2
    GO
    Isoform 7 (identifier: P54750-7) [UniParc]FASTAAdd to Basket

    Also known as: PDE1A8

    The sequence of this isoform differs from the canonical sequence as follows:
         2-34: GSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR
         522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL

    Show »
    Length:537
    Mass (Da):61,512
    Checksum:i9187F614548EB3FF
    GO
    Isoform 8 (identifier: P54750-8) [UniParc]FASTAAdd to Basket

    Also known as: PDE1A11

    The sequence of this isoform differs from the canonical sequence as follows:
         2-72: GSSATEIEEL...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE
         522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS

    Show »
    Length:512
    Mass (Da):58,671
    Checksum:i85C9BC1242D9B55B
    GO
    Isoform 9 (identifier: P54750-9) [UniParc]FASTAAdd to Basket

    Also known as: PDE1A12

    The sequence of this isoform differs from the canonical sequence as follows:
         2-72: GSSATEIEEL...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE
         522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL

    Show »
    Length:519
    Mass (Da):59,402
    Checksum:i8943F30315077A73
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2 – 7271GSSAT…IDETR → MGKKINKLFCFNFLVQCFRG KSKPSKCQIRKKVKNHIE in isoform 3, isoform 8 and isoform 9. 1 PublicationVSP_004548Add
    BLAST
    Alternative sequencei2 – 3433GSSAT…RLKGI → MDDHVTIRKKHLQRPIFR in isoform 2, isoform 6 and isoform 7. 2 PublicationsVSP_004547Add
    BLAST
    Alternative sequencei522 – 53514EARTS…EFIHQ → GESDLHKNSEDLVNAEEKHD ETHS in isoform 4, isoform 6 and isoform 8. 1 PublicationVSP_004549Add
    BLAST
    Alternative sequencei522 – 53514EARTS…EFIHQ → GSVVYEALLPSLSVFTSPLR VWITSSRFLLL in isoform 5, isoform 7 and isoform 9. CuratedVSP_004550Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U40370 mRNA. Translation: AAC50436.1.
    AB038224 Genomic DNA. Translation: BAB20049.1.
    AB038224 Genomic DNA. Translation: BAB20050.1.
    AB038224 Genomic DNA. Translation: BAB20051.1.
    AB038224 Genomic DNA. Translation: BAB20052.1.
    AB038224 Genomic DNA. Translation: BAB20053.1.
    AB038224 Genomic DNA. Translation: BAB20054.1.
    AB038224 Genomic DNA. Translation: BAB20055.1.
    AB038224 Genomic DNA. Translation: BAB20056.1.
    AB038224 Genomic DNA. Translation: BAB20057.1.
    AJ401610 mRNA. Translation: CAC82208.1.
    AL110263 mRNA. Translation: CAB53703.1.
    CH471058 Genomic DNA. Translation: EAX10966.1.
    CH471058 Genomic DNA. Translation: EAX10974.1.
    BC022480 mRNA. Translation: AAH22480.1.
    CCDSiCCDS2285.1. [P54750-4]
    CCDS33344.1. [P54750-1]
    PIRiT14783.
    RefSeqiNP_001003683.1. NM_001003683.2. [P54750-1]
    NP_001245242.1. NM_001258313.1.
    NP_001245243.1. NM_001258314.1.
    NP_005010.2. NM_005019.4. [P54750-4]
    XP_005246692.1. XM_005246635.2. [P54750-5]
    XP_005246693.1. XM_005246636.1.
    XP_005246694.1. XM_005246637.1.
    XP_006712637.1. XM_006712574.1. [P54750-5]
    XP_006712638.1. XM_006712575.1. [P54750-5]
    XP_006712639.1. XM_006712576.1. [P54750-5]
    XP_006712640.1. XM_006712577.1. [P54750-5]
    XP_006712641.1. XM_006712578.1. [P54750-4]
    XP_006712642.1. XM_006712579.1. [P54750-1]
    UniGeneiHs.191046.
    Hs.742174.

    Genome annotation databases

    EnsembliENST00000351439; ENSP00000309269; ENSG00000115252. [P54750-2]
    ENST00000358139; ENSP00000350858; ENSG00000115252. [P54750-1]
    ENST00000409365; ENSP00000386767; ENSG00000115252. [P54750-6]
    ENST00000410103; ENSP00000387037; ENSG00000115252. [P54750-1]
    ENST00000435564; ENSP00000410309; ENSG00000115252. [P54750-4]
    GeneIDi5136.
    KEGGihsa:5136.
    UCSCiuc002uoq.2. human. [P54750-4]
    uc002uor.4. human. [P54750-2]
    uc002uos.4. human. [P54750-1]
    uc002uou.4. human. [P54750-3]

    Polymorphism databases

    DMDMi1705942.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U40370 mRNA. Translation: AAC50436.1 .
    AB038224 Genomic DNA. Translation: BAB20049.1 .
    AB038224 Genomic DNA. Translation: BAB20050.1 .
    AB038224 Genomic DNA. Translation: BAB20051.1 .
    AB038224 Genomic DNA. Translation: BAB20052.1 .
    AB038224 Genomic DNA. Translation: BAB20053.1 .
    AB038224 Genomic DNA. Translation: BAB20054.1 .
    AB038224 Genomic DNA. Translation: BAB20055.1 .
    AB038224 Genomic DNA. Translation: BAB20056.1 .
    AB038224 Genomic DNA. Translation: BAB20057.1 .
    AJ401610 mRNA. Translation: CAC82208.1 .
    AL110263 mRNA. Translation: CAB53703.1 .
    CH471058 Genomic DNA. Translation: EAX10966.1 .
    CH471058 Genomic DNA. Translation: EAX10974.1 .
    BC022480 mRNA. Translation: AAH22480.1 .
    CCDSi CCDS2285.1. [P54750-4 ]
    CCDS33344.1. [P54750-1 ]
    PIRi T14783.
    RefSeqi NP_001003683.1. NM_001003683.2. [P54750-1 ]
    NP_001245242.1. NM_001258313.1.
    NP_001245243.1. NM_001258314.1.
    NP_005010.2. NM_005019.4. [P54750-4 ]
    XP_005246692.1. XM_005246635.2. [P54750-5 ]
    XP_005246693.1. XM_005246636.1.
    XP_005246694.1. XM_005246637.1.
    XP_006712637.1. XM_006712574.1. [P54750-5 ]
    XP_006712638.1. XM_006712575.1. [P54750-5 ]
    XP_006712639.1. XM_006712576.1. [P54750-5 ]
    XP_006712640.1. XM_006712577.1. [P54750-5 ]
    XP_006712641.1. XM_006712578.1. [P54750-4 ]
    XP_006712642.1. XM_006712579.1. [P54750-1 ]
    UniGenei Hs.191046.
    Hs.742174.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1LXQ model - A 154-432 [» ]
    ProteinModelPortali P54750.
    SMRi P54750. Positions 142-520.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111162. 4 interactions.
    IntActi P54750. 1 interaction.
    MINTi MINT-4717501.

    Chemistry

    BindingDBi P54750.
    ChEMBLi CHEMBL2095150.
    GuidetoPHARMACOLOGYi 1294.

    PTM databases

    PhosphoSitei P54750.

    Polymorphism databases

    DMDMi 1705942.

    Proteomic databases

    MaxQBi P54750.
    PaxDbi P54750.
    PRIDEi P54750.

    Protocols and materials databases

    DNASUi 5136.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000351439 ; ENSP00000309269 ; ENSG00000115252 . [P54750-2 ]
    ENST00000358139 ; ENSP00000350858 ; ENSG00000115252 . [P54750-1 ]
    ENST00000409365 ; ENSP00000386767 ; ENSG00000115252 . [P54750-6 ]
    ENST00000410103 ; ENSP00000387037 ; ENSG00000115252 . [P54750-1 ]
    ENST00000435564 ; ENSP00000410309 ; ENSG00000115252 . [P54750-4 ]
    GeneIDi 5136.
    KEGGi hsa:5136.
    UCSCi uc002uoq.2. human. [P54750-4 ]
    uc002uor.4. human. [P54750-2 ]
    uc002uos.4. human. [P54750-1 ]
    uc002uou.4. human. [P54750-3 ]

    Organism-specific databases

    CTDi 5136.
    GeneCardsi GC02M182971.
    HGNCi HGNC:8774. PDE1A.
    HPAi HPA022151.
    MIMi 171890. gene.
    neXtProti NX_P54750.
    PharmGKBi PA33122.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG139098.
    HOVERGENi HBG056120.
    KOi K13755.
    OMAi QEEEMNV.
    OrthoDBi EOG7X9G6J.
    PhylomeDBi P54750.
    TreeFami TF314638.

    Enzyme and pathway databases

    Reactomei REACT_15408. Cam-PDE 1 activation.
    REACT_19327. G alpha (s) signalling events.
    REACT_23767. cGMP effects.

    Miscellaneous databases

    ChiTaRSi PDE1A. human.
    GeneWikii PDE1A.
    GenomeRNAii 5136.
    NextBioi 19802.
    PROi P54750.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P54750.
    Bgeei P54750.
    Genevestigatori P54750.

    Family and domain databases

    Gene3Di 1.10.1300.10. 2 hits.
    InterProi IPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    IPR013706. PDEase_N.
    [Graphical view ]
    Pfami PF00233. PDEase_I. 1 hit.
    PF08499. PDEase_I_N. 1 hit.
    [Graphical view ]
    PRINTSi PR00387. PDIESTERASE1.
    SMARTi SM00471. HDc. 1 hit.
    [Graphical view ]
    PROSITEi PS00126. PDEASE_I. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases."
      Loughney K., Martins T.J., Harris E.A.S., Sadhu K., Hicks J.B., Sonnenburg W.K., Beavo J.A., Ferguson K.
      J. Biol. Chem. 271:796-806(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Human Ca2+/calmodulin-dependent phosphodiesterase PDE1A: novel splice variants, their specific expression, genomic organization, and chromosomal localization."
      Michibata H., Yanaka N., Kanoh Y., Okumura K., Omori K.
      Biochim. Biophys. Acta 1517:278-287(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8 AND 9).
      Tissue: Heart.
    3. "Isolation and differential tissue distribution of two human cDNAs encoding PDE1 splice variants."
      Fidock M.D., Miller M., Lanfear J.
      Cell. Signal. 14:53-60(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Uterus.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Tissue: Brain.

    Entry informationi

    Entry nameiPDE1A_HUMAN
    AccessioniPrimary (citable) accession number: P54750
    Secondary accession number(s): D3DPG5
    , Q86VZ0, Q9C0K8, Q9C0K9, Q9C0L0, Q9C0L1, Q9C0L2, Q9C0L3, Q9C0L4, Q9UFX3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 150 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3