P54750 (PDE1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 135.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A Short name=Cam-PDE 1A EC=3.1.4.17 Alternative name(s): 61 kDa Cam-PDE hCam-1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 535 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP. |
| Catalytic activity | Nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate. |
| Cofactor | Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity. |
| Enzyme regulation | Type I PDE are activated by the binding of calmodulin in the presence of Ca2+. |
| Subunit structure | Homodimer By similarity. |
| Tissue specificity | Several tissues, including brain, kidney, testes and heart. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Calmodulin-binding Metal-binding cAMP cGMP |
| Molecular function | Hydrolase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | activation of phospholipase C activity Traceable author statement. Source: Reactome blood coagulationTraceable author statement. Source: Reactome epidermal growth factor receptor signaling pathwayTraceable author statement. Source: Reactome fibroblast growth factor receptor signaling pathwayTraceable author statement. Source: Reactome nerve growth factor receptor signaling pathwayTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | calmodulin-dependent cyclic-nucleotide phosphodiesterase activity Traceable author statement Ref.1. Source: ProtInc metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P54750-1) Also known as: PDE1A3; PDE1A6; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P54750-2) Also known as: PDE1A4; PDE1A5; The sequence of this isoform differs from the canonical sequence as follows: 1-34: MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR | ||||||
| Isoform 3 (identifier: P54750-3) Also known as: PDE1A10; The sequence of this isoform differs from the canonical sequence as follows: 1-72: MGSSATEIEE...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE | ||||||
| Isoform 4 (identifier: P54750-4) Also known as: PDE1A5; The sequence of this isoform differs from the canonical sequence as follows: 522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS | ||||||
| Isoform 5 (identifier: P54750-5) Also known as: PDE1A9; The sequence of this isoform differs from the canonical sequence as follows: 522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL | ||||||
| Isoform 6 (identifier: P54750-6) Also known as: PDE1A1; The sequence of this isoform differs from the canonical sequence as follows: 1-34: MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR 522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS | ||||||
| Isoform 7 (identifier: P54750-7) Also known as: PDE1A8; The sequence of this isoform differs from the canonical sequence as follows: 1-34: MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR 522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL | ||||||
| Isoform 8 (identifier: P54750-8) Also known as: PDE1A11; The sequence of this isoform differs from the canonical sequence as follows: 1-72: MGSSATEIEE...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE 522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS | ||||||
| Isoform 9 (identifier: P54750-9) Also known as: PDE1A12; The sequence of this isoform differs from the canonical sequence as follows: 1-72: MGSSATEIEE...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE 522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 535 | 534 | Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A | PRO_0000198785 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 24 – 44 | 21 | Calmodulin-binding By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 193 – 515 | 323 | Catalytic By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 219 | 1 | Proton donor By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 223 | 1 | Divalent metal cation 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 259 | 1 | Divalent metal cation 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 260 | 1 | Divalent metal cation 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 260 | 1 | Divalent metal cation 2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 366 | 1 | Divalent metal cation 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 72 | 72 | MGSSA…IDETR → MGKKINKLFCFNFLVQCFRG KSKPSKCQIRKKVKNHIE in isoform 3, isoform 8 and isoform 9. | VSP_004548 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 34 | 34 | MGSSA…RLKGI → MDDHVTIRKKHLQRPIFR in isoform 2, isoform 6 and isoform 7. | VSP_004547 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 522 – 535 | 14 | EARTS…EFIHQ → GESDLHKNSEDLVNAEEKHD ETHS in isoform 4, isoform 6 and isoform 8. | VSP_004549 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 522 – 535 | 14 | EARTS…EFIHQ → GSVVYEALLPSLSVFTSPLR VWITSSRFLLL in isoform 5, isoform 7 and isoform 9. | VSP_004550 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 154 – 157 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 163 – 169 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 174 – 185 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 188 – 191 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 196 – 208 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 212 – 214 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 216 – 219 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 220 – 233 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 237 – 239 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 240 – 242 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 245 – 257 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 258 – 261 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 267 – 272 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 276 – 280 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 281 – 283 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 286 – 297 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 298 – 300 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 306 – 309 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 312 – 327 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 331 – 333 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 334 – 346 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 354 – 365 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 368 – 370 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 373 – 396 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 407 – 409 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 412 – 422 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 424 – 430 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases." Loughney K., Martins T.J., Harris E.A.S., Sadhu K., Hicks J.B., Sonnenburg W.K., Beavo J.A., Ferguson K. J. Biol. Chem. 271:796-806(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Human Ca2+/calmodulin-dependent phosphodiesterase PDE1A: novel splice variants, their specific expression, genomic organization, and chromosomal localization." Michibata H., Yanaka N., Kanoh Y., Okumura K., Omori K. Biochim. Biophys. Acta 1517:278-287(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8 AND 9). Tissue: Heart. |
| [3] | "Isolation and differential tissue distribution of two human cDNAs encoding PDE1 splice variants." Fidock M.D., Miller M., Lanfear J. Cell. Signal. 14:53-60(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Uterus. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U40370 mRNA. Translation: AAC50436.1. AB038224 Genomic DNA. Translation: BAB20049.1. AB038224 Genomic DNA. Translation: BAB20050.1. AB038224 Genomic DNA. Translation: BAB20051.1. AB038224 Genomic DNA. Translation: BAB20052.1. AB038224 Genomic DNA. Translation: BAB20053.1. AB038224 Genomic DNA. Translation: BAB20054.1. AB038224 Genomic DNA. Translation: BAB20055.1. AB038224 Genomic DNA. Translation: BAB20056.1. AB038224 Genomic DNA. Translation: BAB20057.1. AJ401610 mRNA. Translation: CAC82208.1. AL110263 mRNA. Translation: CAB53703.1. CH471058 Genomic DNA. Translation: EAX10966.1. CH471058 Genomic DNA. Translation: EAX10974.1. BC022480 mRNA. Translation: AAH22480.1. | ||||||||||||
| IPI | IPI00008282. IPI00171816. IPI00221139. IPI00221140. IPI00335536. IPI00377231. IPI00395021. IPI00395024. IPI00399272. | ||||||||||||
| PIR | T14783. | ||||||||||||
| RefSeq | NP_001003683.1. NM_001003683.2. NP_001245242.1. NM_001258313.1. NP_001245243.1. NM_001258314.1. NP_005010.2. NM_005019.4. | ||||||||||||
| UniGene | Hs.191046. Hs.742174. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P54750. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P54750. 1 interaction. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P54750. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 1705942. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P54750. | ||||||||||||
| PRIDE | P54750. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 5136. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000331935; ENSP00000331574; ENSG00000115252. ENST00000346717; ENSP00000329112; ENSG00000115252. ENST00000351439; ENSP00000309269; ENSG00000115252. ENST00000358139; ENSP00000350858; ENSG00000115252. ENST00000409365; ENSP00000386767; ENSG00000115252. ENST00000410103; ENSP00000387037; ENSG00000115252. ENST00000435564; ENSP00000410309; ENSG00000115252. ENST00000456212; ENSP00000408874; ENSG00000115252. | ||||||||||||
| GeneID | 5136. | ||||||||||||
| KEGG | hsa:5136. | ||||||||||||
| UCSC | uc002uoq.1. human. uc002uor.3. human. uc002uos.3. human. uc002uou.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5136. | ||||||||||||
| GeneCards | GC02M182971. | ||||||||||||
| HGNC | HGNC:8774. PDE1A. | ||||||||||||
| HPA | HPA022151. | ||||||||||||
| MIM | 171890. gene. | ||||||||||||
| neXtProt | NX_P54750. | ||||||||||||
| PharmGKB | PA33122. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG139098. | ||||||||||||
| HOVERGEN | HBG056120. | ||||||||||||
| KO | K13755. | ||||||||||||
| OMA | RKSYHMV. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_116125. Disease. REACT_604. Hemostasis. REACT_6900. Immune System. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P54750. | ||||||||||||
| Bgee | P54750. | ||||||||||||
| Genevestigator | P54750. | ||||||||||||
| GermOnline | ENSG00000115252. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.1300.10. 2 hits. | ||||||||||||
| InterPro | IPR003607. HD/PDEase_dom. IPR023088. PDEase. IPR002073. PDEase_catalytic_dom. IPR023174. PDEase_CS. IPR013706. PDEase_N. [Graphical view] | ||||||||||||
| Pfam | PF00233. PDEase_I. 1 hit. PF08499. PDEase_I_N. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00387. PDIESTERASE1. | ||||||||||||
| SMART | SM00471. HDc. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P54750. | ||||||||||||
| ChEMBL | CHEMBL3421. | ||||||||||||
| ChiTaRS | PDE1A. human. | ||||||||||||
| GenomeRNAi | 5136. | ||||||||||||
| NextBio | 19802. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PDE1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P54750 Secondary accession number(s): D3DPG5 Q9UFX3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
