Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/potassium-transporting ATPase subunit beta-3

Gene

ATP1B3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-3 subunit is not known.

GO - Molecular functioni

  1. ATPase activator activity Source: BHF-UCL
  2. ATPase binding Source: BHF-UCL
  3. sodium:potassium-exchanging ATPase activity Source: BHF-UCL

GO - Biological processi

  1. blood coagulation Source: Reactome
  2. cellular potassium ion homeostasis Source: BHF-UCL
  3. cellular sodium ion homeostasis Source: BHF-UCL
  4. ion transmembrane transport Source: Reactome
  5. leukocyte migration Source: Reactome
  6. membrane repolarization Source: BHF-UCL
  7. positive regulation of ATPase activity Source: BHF-UCL
  8. positive regulation of potassium ion import Source: BHF-UCL
  9. positive regulation of potassium ion transmembrane transporter activity Source: BHF-UCL
  10. positive regulation of sodium ion export from cell Source: BHF-UCL
  11. potassium ion import Source: BHF-UCL
  12. protein localization to plasma membrane Source: BHF-UCL
  13. protein stabilization Source: BHF-UCL
  14. sodium ion export from cell Source: BHF-UCL
  15. transmembrane transport Source: Reactome
  16. transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Ion transport, Potassium transport, Sodium transport, Sodium/potassium transport, Transport

Keywords - Ligandi

Potassium, Sodium

Enzyme and pathway databases

ReactomeiREACT_12560. Basigin interactions.
REACT_25149. Ion transport by P-type ATPases.

Protein family/group databases

TCDBi3.A.3.1.1. the p-type atpase (p-atpase) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/potassium-transporting ATPase subunit beta-3
Alternative name(s):
Sodium/potassium-dependent ATPase subunit beta-3
Short name:
ATPB-3
CD_antigen: CD298
Gene namesi
Name:ATP1B3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:806. ATP1B3.

Subcellular locationi

Cell membrane 1 Publication; Single-pass type II membrane protein 1 Publication. Melanosome 1 Publication
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3535CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei36 – 5621Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST
Topological domaini57 – 279223ExtracellularSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. caveola Source: Ensembl
  2. extracellular vesicular exosome Source: UniProtKB
  3. melanosome Source: UniProtKB-SubCell
  4. plasma membrane Source: BHF-UCL
  5. sodium:potassium-exchanging ATPase complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA68.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 279279Sodium/potassium-transporting ATPase subunit beta-3PRO_0000219108Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi124 – 1241N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi128 ↔ 144By similarity
Disulfide bondi154 ↔ 170By similarity
Disulfide bondi191 ↔ 250By similarity
Glycosylationi240 – 2401N-linked (GlcNAc...)1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiP54709.
PaxDbiP54709.
PRIDEiP54709.

PTM databases

PhosphoSiteiP54709.

Expressioni

Gene expression databases

BgeeiP54709.
CleanExiHS_ATP1B3.
ExpressionAtlasiP54709. baseline and differential.
GenevestigatoriP54709.

Organism-specific databases

HPAiCAB020697.
HPA048963.

Interactioni

Subunit structurei

Composed of three subunits: alpha (catalytic), beta and gamma.

Protein-protein interaction databases

BioGridi106973. 52 interactions.
IntActiP54709. 4 interactions.
MINTiMINT-5001083.
STRINGi9606.ENSP00000286371.

Structurei

3D structure databases

ProteinModelPortaliP54709.
SMRiP54709. Positions 16-279.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni186 – 27994immunoglobulin-likeBy similarityAdd
BLAST

Domaini

The C-terminal lobe folds into an immunoglobulin-like domain and may mediate cell adhesion properties.By similarity

Sequence similaritiesi

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG263581.
GeneTreeiENSGT00550000074530.
HOGENOMiHOG000039248.
HOVERGENiHBG050603.
InParanoidiP54709.
KOiK01540.
OMAiANFGYSK.
PhylomeDBiP54709.
TreeFamiTF314618.

Family and domain databases

InterProiIPR000402. Na/K_ATPase_sub_beta.
[Graphical view]
PANTHERiPTHR11523. PTHR11523. 1 hit.
PfamiPF00287. Na_K-ATPase. 1 hit.
[Graphical view]
TIGRFAMsiTIGR01107. Na_K_ATPase_bet. 1 hit.
PROSITEiPS00390. ATPASE_NA_K_BETA_1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P54709-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTKNEKKSLN QSLAEWKLFI YNPTTGEFLG RTAKSWGLIL LFYLVFYGFL
60 70 80 90 100
AALFSFTMWV MLQTLNDEVP KYRDQIPSPG LMVFPKPVTA LEYTFSRSDP
110 120 130 140 150
TSYAGYIEDL KKFLKPYTLE EQKNLTVCPD GALFEQKGPV YVACQFPISL
160 170 180 190 200
LQACSGMNDP DFGYSQGNPC ILVKMNRIIG LKPEGVPRID CVSKNEDIPN
210 220 230 240 250
VAVYPHNGMI DLKYFPYYGK KLHVGYLQPL VAVQVSFAPN NTGKEVTVEC
260 270
KIDGSANLKS QDDRDKFLGR VMFKITARA
Length:279
Mass (Da):31,513
Last modified:October 1, 1996 - v1
Checksum:iD92ECB4F0F6EBFE5
GO
Isoform 2 (identifier: P54709-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSW → MLSEGDILFSSLLSSPSLFWPP
     195-279: NEDIPNVAVY...RVMFKITARA → TNNVKDGMKIYQM

Note: No experimental confirmation available.

Show »
Length:193
Mass (Da):21,713
Checksum:i9A6F866ABF2DD7E1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636MTKNE…TAKSW → MLSEGDILFSSLLSSPSLFW PP in isoform 2. 1 PublicationVSP_056686Add
BLAST
Alternative sequencei195 – 27985NEDIP…ITARA → TNNVKDGMKIYQM in isoform 2. 1 PublicationVSP_056687Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U51478 mRNA. Translation: AAC50665.1.
AF005896
, AF005890, AF005891, AF005892, AF005893, AF005894, AF005895 Genomic DNA. Translation: AAB61713.1.
AK293697 mRNA. Translation: BAH11573.1.
AC112504 Genomic DNA. No translation available.
BC011835 mRNA. Translation: AAH11835.1.
CCDSiCCDS3121.1. [P54709-1]
PIRiG02485.
RefSeqiNP_001670.1. NM_001679.2. [P54709-1]
UniGeneiHs.477789.

Genome annotation databases

EnsembliENST00000286371; ENSP00000286371; ENSG00000069849. [P54709-1]
GeneIDi483.
KEGGihsa:483.
UCSCiuc003eug.1. human. [P54709-1]

Polymorphism databases

DMDMi1703470.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U51478 mRNA. Translation: AAC50665.1.
AF005896
, AF005890, AF005891, AF005892, AF005893, AF005894, AF005895 Genomic DNA. Translation: AAB61713.1.
AK293697 mRNA. Translation: BAH11573.1.
AC112504 Genomic DNA. No translation available.
BC011835 mRNA. Translation: AAH11835.1.
CCDSiCCDS3121.1. [P54709-1]
PIRiG02485.
RefSeqiNP_001670.1. NM_001679.2. [P54709-1]
UniGeneiHs.477789.

3D structure databases

ProteinModelPortaliP54709.
SMRiP54709. Positions 16-279.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106973. 52 interactions.
IntActiP54709. 4 interactions.
MINTiMINT-5001083.
STRINGi9606.ENSP00000286371.

Chemistry

ChEMBLiCHEMBL2095186.

Protein family/group databases

TCDBi3.A.3.1.1. the p-type atpase (p-atpase) superfamily.

PTM databases

PhosphoSiteiP54709.

Polymorphism databases

DMDMi1703470.

Proteomic databases

MaxQBiP54709.
PaxDbiP54709.
PRIDEiP54709.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000286371; ENSP00000286371; ENSG00000069849. [P54709-1]
GeneIDi483.
KEGGihsa:483.
UCSCiuc003eug.1. human. [P54709-1]

Organism-specific databases

CTDi483.
GeneCardsiGC03P141594.
HGNCiHGNC:806. ATP1B3.
HPAiCAB020697.
HPA048963.
MIMi601867. gene.
neXtProtiNX_P54709.
PharmGKBiPA68.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG263581.
GeneTreeiENSGT00550000074530.
HOGENOMiHOG000039248.
HOVERGENiHBG050603.
InParanoidiP54709.
KOiK01540.
OMAiANFGYSK.
PhylomeDBiP54709.
TreeFamiTF314618.

Enzyme and pathway databases

ReactomeiREACT_12560. Basigin interactions.
REACT_25149. Ion transport by P-type ATPases.

Miscellaneous databases

GeneWikiiATP1B3.
GenomeRNAii483.
NextBioi2005.
PROiP54709.
SOURCEiSearch...

Gene expression databases

BgeeiP54709.
CleanExiHS_ATP1B3.
ExpressionAtlasiP54709. baseline and differential.
GenevestigatoriP54709.

Family and domain databases

InterProiIPR000402. Na/K_ATPase_sub_beta.
[Graphical view]
PANTHERiPTHR11523. PTHR11523. 1 hit.
PfamiPF00287. Na_K-ATPase. 1 hit.
[Graphical view]
TIGRFAMsiTIGR01107. Na_K_ATPase_bet. 1 hit.
PROSITEiPS00390. ATPASE_NA_K_BETA_1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Placenta.
  2. "Structural organization and chromosomal localization of the human Na,K- ATPase beta 3 subunit gene and pseudogene."
    Malik N., Canfield V., Sanchez-Watts G., Watts A.G., Scherer S., Beatty B.G., Gros P., Levenson R.
    Mamm. Genome 9:136-143(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Cerebellum.
  4. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  6. "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry."
    Zhang H., Li X.-J., Martin D.B., Aebersold R.
    Nat. Biotechnol. 21:660-666(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT ASN-240.
  7. Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS].
    Tissue: Melanoma.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiAT1B3_HUMAN
AccessioniPrimary (citable) accession number: P54709
Secondary accession number(s): B7Z1N7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: April 1, 2015
This is version 133 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.