ATP1B3

Functionⁱ

This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na⁺ and K⁺ ions across the plasma membrane. The exact function of the beta-3 subunit is not known.

GO - Molecular functionⁱ

ATPase activator activity
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
ATPase binding
Source: BHF-UCL
Inferred from physical interactionⁱ
- 10636900
sodium:potassium-exchanging ATPase activity
Source: BHF-UCL
Inferred from direct assayⁱ
- 19542013

Complete GO annotation...

GO - Biological processⁱ

cellular potassium ion homeostasis
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
- 19542013
cellular sodium ion homeostasis
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
- 19542013
ion transmembrane transport Source: Reactome
leukocyte migration Source: Reactome
membrane repolarization
Source: BHF-UCL
Inferred from direct assayⁱ
- 19542013
positive regulation of ATPase activity
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
positive regulation of potassium ion import
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
positive regulation of potassium ion transmembrane transporter activity
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
positive regulation of sodium ion export from cell
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
potassium ion import
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
- 19542013
protein localization to plasma membrane
Source: BHF-UCL
Inferred from direct assayⁱ
- 18522992
protein stabilization
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
regulation of cardiac conduction Source: Reactome
sodium ion export from cell
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
- 19542013
transport
Source: ProtInc
Traceable author statementⁱ
- 8798450

Complete GO annotation...

Keywordsⁱ

Biological process	Ion transport, Potassium transport, Sodium transport, Sodium/potassium transport, Transport
Ligand	Potassium, Sodium

Enzyme and pathway databases

Reactomeⁱ	R-HSA-210991. Basigin interactions. R-HSA-5578775. Ion homeostasis. R-HSA-936837. Ion transport by P-type ATPases.

Reactomeⁱ

R-HSA-210991. Basigin interactions.
R-HSA-5578775. Ion homeostasis.
R-HSA-936837. Ion transport by P-type ATPases.

Protein family/group databases

TCDBⁱ	3.A.3.1.1. the p-type atpase (p-atpase) superfamily.

TCDBⁱ

3.A.3.1.1. the p-type atpase (p-atpase) superfamily.

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Sodium/potassium-transporting ATPase subunit beta-3 Alternative name(s): Sodium/potassium-dependent ATPase subunit beta-3 Short name: ATPB-3 CD_antigen: CD298
Gene namesⁱ	Name:ATP1B3
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database More...HGNCⁱ	HGNC:806. ATP1B3.

HGNCⁱ

HGNC:806. ATP1B3.

Subcellular locationⁱ

Note:

Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 35	CytoplasmicSequence analysisAdd BLAST	35
Transmembraneⁱ	36 – 56	Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST	21
Topological domainⁱ	57 – 279	ExtracellularSequence analysisAdd BLAST	223

GO - Cellular componentⁱ

caveola Source: Ensembl
extracellular exosome
Source: UniProtKB
Inferred from direct assayⁱ
- 20458337
melanosome Source: UniProtKB-SubCell
plasma membrane
Source: BHF-UCL
Inferred from direct assayⁱ
- 18522992
sodium:potassium-exchanging ATPase complex
Source: BHF-UCL
Inferred from direct assayⁱ
- 10636900
- 19542013

Complete GO annotation...

Keywords - Cellular componentⁱ

Cell membrane, Membrane

Pathology & Biotechⁱ

Organism-specific databases

Open Targets More...OpenTargetsⁱ	ENSG00000069849.
PharmGKBⁱ	PA68.

Chemistry databases

ChEMBLⁱ	CHEMBL2095186.
Drug and drug target database More...DrugBankⁱ	DB09479. Rubidium chloride Rb-82.

Polymorphism and mutation databases

BioMutaⁱ	ATP1B3.
DMDMⁱ	1703470.

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000219108	1 – 279	Sodium/potassium-transporting ATPase subunit beta-3Add BLAST		279

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Glycosylationⁱ	124	N-linked (GlcNAc...) asparagineSequence analysis	1
Disulfide bondⁱ	128 ↔ 144	By similarity
Disulfide bondⁱ	154 ↔ 170	By similarity
Disulfide bondⁱ	191 ↔ 250	By similarity
Glycosylationⁱ	240	N-linked (GlcNAc...) asparagine1 Publication	1

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

EPDⁱ	P54709.
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P54709.
PaxDbⁱ	P54709.
PeptideAtlas More...PeptideAtlasⁱ	P54709.
PRIDEⁱ	P54709.
TopDownProteomicsⁱ	P54709-1. [P54709-1]

PTM databases

iPTMnetⁱ	P54709.
PhosphoSitePlusⁱ	P54709.
SwissPalmⁱ	P54709.

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000069849.
CleanExⁱ	HS_ATP1B3.
ExpressionAtlasⁱ	P54709. baseline and differential.
Genevisibleⁱ	P54709. HS.

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB020697. HPA048963.

HPAⁱ

CAB020697.
HPA048963.

Interactionⁱ

Subunit structureⁱ

Composed of three subunits: alpha (catalytic), beta and gamma.

GO - Molecular functionⁱ

ATPase binding
Source: BHF-UCL
Inferred from physical interactionⁱ
- 10636900

Complete GO annotation...

Protein-protein interaction databases

BioGridⁱ	106973. 102 interactors.
IntActⁱ	P54709. 9 interactors.
Molecular INTeraction database More...MINTⁱ	MINT-5001083.
STRINGⁱ	9606.ENSP00000286371.

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P54709.
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	186 – 279	immunoglobulin-likeBy similarityAdd BLAST		94

Domainⁱ

The C-terminal lobe folds into an immunoglobulin-like domain and may mediate cell adhesion properties.By similarity

Sequence similaritiesⁱ

Belongs to the X(+)/potassium ATPases subunit beta family.Curated

Keywords - Domainⁱ

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG3927. Eukaryota. ENOG411150A. LUCA.
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00550000074530.
HOGENOMⁱ	HOG000039248.
HOVERGENⁱ	HBG050603.
InParanoidⁱ	P54709.
KEGG Orthology (KO) More...KOⁱ	K01540.
OMAⁱ	SITINCE.
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0DJ4.
PhylomeDBⁱ	P54709.
TreeFamⁱ	TF314618.

Family and domain databases

InterProⁱ	View protein in InterPro IPR000402. Na/K_ATPase_sub_beta.
PANTHERⁱ	PTHR11523. PTHR11523. 1 hit.
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00287. Na_K-ATPase. 1 hit.
TIGRFAMsⁱ	TIGR01107. Na_K_ATPase_bet. 1 hit.
PROSITEⁱ	View protein in PROSITE PS00390. ATPASE_NA_K_BETA_1. 1 hit.

Sequences (2)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket Added to basket

Isoform 1 (identifier: P54709-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTKNEKKSLN QSLAEWKLFI YNPTTGEFLG RTAKSWGLIL LFYLVFYGFL 
        60         70         80         90        100
AALFSFTMWV MLQTLNDEVP KYRDQIPSPG LMVFPKPVTA LEYTFSRSDP 
       110        120        130        140        150
TSYAGYIEDL KKFLKPYTLE EQKNLTVCPD GALFEQKGPV YVACQFPISL 
       160        170        180        190        200
LQACSGMNDP DFGYSQGNPC ILVKMNRIIG LKPEGVPRID CVSKNEDIPN 
       210        220        230        240        250
VAVYPHNGMI DLKYFPYYGK KLHVGYLQPL VAVQVSFAPN NTGKEVTVEC 
       260        270 
KIDGSANLKS QDDRDKFLGR VMFKITARA

Length:279

Mass (Da):31,513

Last modified:October 1, 1996 - v1

Checksum:ⁱD92ECB4F0F6EBFE5

GO

Isoform 2 (identifier: P54709-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-36: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSW → MLSEGDILFSSLLSSPSLFWPP
195-279: NEDIPNVAVY...RVMFKITARA → TNNVKDGMKIYQM

« Hide

        10         20         30         40         50
MLSEGDILFS SLLSSPSLFW PPGLILLFYL VFYGFLAALF SFTMWVMLQT 
        60         70         80         90        100
LNDEVPKYRD QIPSPGLMVF PKPVTALEYT FSRSDPTSYA GYIEDLKKFL 
       110        120        130        140        150
KPYTLEEQKN LTVCPDGALF EQKGPVYVAC QFPISLLQAC SGMNDPDFGY 
       160        170        180        190 
SQGNPCILVK MNRIIGLKPE GVPRIDCVSK TNNVKDGMKI YQM

Note: No experimental confirmation available.

Show »

Length:193

Mass (Da):21,713

Checksum:ⁱ9A6F866ABF2DD7E1

GO

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_056686	1 – 36	MTKNE…TAKSW → MLSEGDILFSSLLSSPSLFW PP in isoform 2. 1 PublicationAdd BLAST		36
Alternative sequenceⁱVSP_056687	195 – 279	NEDIP…ITARA → TNNVKDGMKIYQM in isoform 2. 1 PublicationAdd BLAST		85

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U51478 mRNA. Translation: AAC50665.1. AF005896 AF005895 Genomic DNA. Translation: AAB61713.1. AK293697 mRNA. Translation: BAH11573.1. AC112504 Genomic DNA. No translation available. BC011835 mRNA. Translation: AAH11835.1.
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS3121.1. [P54709-1]
PIRⁱ	G02485.
NCBI Reference Sequences More...RefSeqⁱ	NP_001670.1. NM_001679.3. [P54709-1]
UniGeneⁱ	Hs.477789.

Genome annotation databases

Ensemblⁱ	ENST00000286371; ENSP00000286371; ENSG00000069849. [P54709-1]
GeneIDⁱ	483.
KEGGⁱ	hsa:483.
UCSC genome browser More...UCSCⁱ	uc003eug.2. human. [P54709-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U51478 mRNA. Translation: AAC50665.1. AF005896 AF005895 Genomic DNA. Translation: AAB61713.1. AK293697 mRNA. Translation: BAH11573.1. AC112504 Genomic DNA. No translation available. BC011835 mRNA. Translation: AAH11835.1.
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS3121.1. [P54709-1]
PIRⁱ	G02485.
NCBI Reference Sequences More...RefSeqⁱ	NP_001670.1. NM_001679.3. [P54709-1]
UniGeneⁱ	Hs.477789.

3D structure databases

ProteinModelPortalⁱ	P54709.
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	106973. 102 interactors.
IntActⁱ	P54709. 9 interactors.
Molecular INTeraction database More...MINTⁱ	MINT-5001083.
STRINGⁱ	9606.ENSP00000286371.

Chemistry databases

ChEMBLⁱ	CHEMBL2095186.
Drug and drug target database More...DrugBankⁱ	DB09479. Rubidium chloride Rb-82.

Protein family/group databases

TCDBⁱ	3.A.3.1.1. the p-type atpase (p-atpase) superfamily.

TCDBⁱ

3.A.3.1.1. the p-type atpase (p-atpase) superfamily.

PTM databases

iPTMnetⁱ	P54709.
PhosphoSitePlusⁱ	P54709.
SwissPalmⁱ	P54709.

Polymorphism and mutation databases

BioMutaⁱ	ATP1B3.
DMDMⁱ	1703470.

Proteomic databases

EPDⁱ	P54709.
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P54709.
PaxDbⁱ	P54709.
PeptideAtlas More...PeptideAtlasⁱ	P54709.
PRIDEⁱ	P54709.
TopDownProteomicsⁱ	P54709-1. [P54709-1]

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000286371; ENSP00000286371; ENSG00000069849. [P54709-1]
GeneIDⁱ	483.
KEGGⁱ	hsa:483.
UCSC genome browser More...UCSCⁱ	uc003eug.2. human. [P54709-1]

Organism-specific databases

CTDⁱ	483.
GeneCardsⁱ	ATP1B3.
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:806. ATP1B3.
Human Protein Atlas More...HPAⁱ	CAB020697. HPA048963.
MIMⁱ	601867. gene.
neXtProtⁱ	NX_P54709.
Open Targets More...OpenTargetsⁱ	ENSG00000069849.
PharmGKBⁱ	PA68.
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG3927. Eukaryota. ENOG411150A. LUCA.
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00550000074530.
HOGENOMⁱ	HOG000039248.
HOVERGENⁱ	HBG050603.
InParanoidⁱ	P54709.
KEGG Orthology (KO) More...KOⁱ	K01540.
OMAⁱ	SITINCE.
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0DJ4.
PhylomeDBⁱ	P54709.
TreeFamⁱ	TF314618.

Enzyme and pathway databases

Reactomeⁱ	R-HSA-210991. Basigin interactions. R-HSA-5578775. Ion homeostasis. R-HSA-936837. Ion transport by P-type ATPases.

Reactomeⁱ

R-HSA-210991. Basigin interactions.
R-HSA-5578775. Ion homeostasis.
R-HSA-936837. Ion transport by P-type ATPases.

Miscellaneous databases

GeneWikiⁱ	ATP1B3.
GenomeRNAiⁱ	483.
Protein Ontology More...PROⁱ	PR:P54709.
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000069849.
CleanExⁱ	HS_ATP1B3.
ExpressionAtlasⁱ	P54709. baseline and differential.
Genevisibleⁱ	P54709. HS.

Family and domain databases

InterProⁱ	View protein in InterPro IPR000402. Na/K_ATPase_sub_beta.
PANTHERⁱ	PTHR11523. PTHR11523. 1 hit.
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00287. Na_K-ATPase. 1 hit.
TIGRFAMsⁱ	TIGR01107. Na_K_ATPase_bet. 1 hit.
PROSITEⁱ	View protein in PROSITE PS00390. ATPASE_NA_K_BETA_1. 1 hit.
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	AT1B3_HUMAN
Accessionⁱ	P54709Primary (citable) accession number: P54709 Secondary accession number(s): B7Z1N7
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	October 1, 1996
	Last sequence update:	October 1, 1996
	Last modified:	June 7, 2017
	This is version 156 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

Human cell differentiation molecules
CD nomenclature of surface proteins of human leucocytes and list of entries
Human chromosome 3
Human chromosome 3: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
SIMILARITY comments
Index of protein domains and families

Similar proteinsⁱ

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:

100%	UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%	UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%	UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P54709 (AT1B3_HUMAN)

Your basket is currently empty.

Sodium/potassium-transporting ATPase subunit beta-3

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including length and molecular weight.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

Alternative sequence

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

Protein family/group databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Documents

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequences (2)ⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ