Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P54709

- AT1B3_HUMAN

UniProt

P54709 - AT1B3_HUMAN

Protein

Sodium/potassium-transporting ATPase subunit beta-3

Gene

ATP1B3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 128 (01 Oct 2014)
      Sequence version 1 (01 Oct 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-3 subunit is not known.

    GO - Molecular functioni

    1. sodium:potassium-exchanging ATPase activity Source: ProtInc

    GO - Biological processi

    1. blood coagulation Source: Reactome
    2. ion transmembrane transport Source: Reactome
    3. leukocyte migration Source: Reactome
    4. sodium ion transmembrane transport Source: GOC
    5. transmembrane transport Source: Reactome
    6. transport Source: ProtInc

    Keywords - Biological processi

    Ion transport, Potassium transport, Sodium transport, Sodium/potassium transport, Transport

    Keywords - Ligandi

    Potassium, Sodium

    Enzyme and pathway databases

    ReactomeiREACT_12560. Basigin interactions.
    REACT_25149. Ion transport by P-type ATPases.

    Protein family/group databases

    TCDBi3.A.3.1.1. the p-type atpase (p-atpase) superfamily.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sodium/potassium-transporting ATPase subunit beta-3
    Alternative name(s):
    Sodium/potassium-dependent ATPase subunit beta-3
    Short name:
    ATPB-3
    CD_antigen: CD298
    Gene namesi
    Name:ATP1B3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:806. ATP1B3.

    Subcellular locationi

    Cell membrane 1 Publication; Single-pass type II membrane protein 1 Publication. Melanosome 1 Publication
    Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

    GO - Cellular componenti

    1. caveola Source: Ensembl
    2. extracellular vesicular exosome Source: UniProt
    3. melanosome Source: UniProtKB-SubCell
    4. plasma membrane Source: Reactome
    5. sodium:potassium-exchanging ATPase complex Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA68.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 279279Sodium/potassium-transporting ATPase subunit beta-3PRO_0000219108Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi124 – 1241N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi128 ↔ 144By similarity
    Disulfide bondi154 ↔ 170By similarity
    Disulfide bondi191 ↔ 250By similarity
    Glycosylationi240 – 2401N-linked (GlcNAc...)1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiP54709.
    PaxDbiP54709.
    PRIDEiP54709.

    PTM databases

    PhosphoSiteiP54709.

    Expressioni

    Gene expression databases

    ArrayExpressiP54709.
    BgeeiP54709.
    CleanExiHS_ATP1B3.
    GenevestigatoriP54709.

    Organism-specific databases

    HPAiCAB020697.

    Interactioni

    Subunit structurei

    Composed of three subunits: alpha (catalytic), beta and gamma.

    Protein-protein interaction databases

    BioGridi106973. 8 interactions.
    IntActiP54709. 4 interactions.
    MINTiMINT-5001083.
    STRINGi9606.ENSP00000286371.

    Structurei

    3D structure databases

    ProteinModelPortaliP54709.
    SMRiP54709. Positions 16-279.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3535CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini57 – 279223ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei36 – 5621Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni186 – 27994immunoglobulin-likeBy similarityAdd
    BLAST

    Domaini

    The C-terminal lobe folds into an immunoglobulin-like domain and may mediate cell adhesion properties.By similarity

    Sequence similaritiesi

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG263581.
    HOGENOMiHOG000039248.
    HOVERGENiHBG050603.
    InParanoidiP54709.
    KOiK01540.
    OMAiLMISPKP.
    PhylomeDBiP54709.
    TreeFamiTF314618.

    Family and domain databases

    InterProiIPR000402. Na/K_ATPase_sub_beta.
    [Graphical view]
    PANTHERiPTHR11523. PTHR11523. 1 hit.
    PfamiPF00287. Na_K-ATPase. 1 hit.
    [Graphical view]
    TIGRFAMsiTIGR01107. Na_K_ATPase_bet. 1 hit.
    PROSITEiPS00390. ATPASE_NA_K_BETA_1. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P54709-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTKNEKKSLN QSLAEWKLFI YNPTTGEFLG RTAKSWGLIL LFYLVFYGFL    50
    AALFSFTMWV MLQTLNDEVP KYRDQIPSPG LMVFPKPVTA LEYTFSRSDP 100
    TSYAGYIEDL KKFLKPYTLE EQKNLTVCPD GALFEQKGPV YVACQFPISL 150
    LQACSGMNDP DFGYSQGNPC ILVKMNRIIG LKPEGVPRID CVSKNEDIPN 200
    VAVYPHNGMI DLKYFPYYGK KLHVGYLQPL VAVQVSFAPN NTGKEVTVEC 250
    KIDGSANLKS QDDRDKFLGR VMFKITARA 279
    Length:279
    Mass (Da):31,513
    Last modified:October 1, 1996 - v1
    Checksum:iD92ECB4F0F6EBFE5
    GO
    Isoform 2 (identifier: P54709-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSW → MLSEGDILFSSLLSSPSLFWPP
         195-279: NEDIPNVAVY...RVMFKITARA → TNNVKDGMKIYQM

    Note: No experimental confirmation available.

    Show »
    Length:193
    Mass (Da):21,713
    Checksum:i9A6F866ABF2DD7E1
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3636MTKNE…TAKSW → MLSEGDILFSSLLSSPSLFW PP in isoform 2. 1 PublicationVSP_056686Add
    BLAST
    Alternative sequencei195 – 27985NEDIP…ITARA → TNNVKDGMKIYQM in isoform 2. 1 PublicationVSP_056687Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U51478 mRNA. Translation: AAC50665.1.
    AF005896
    , AF005890, AF005891, AF005892, AF005893, AF005894, AF005895 Genomic DNA. Translation: AAB61713.1.
    AK293697 mRNA. Translation: BAH11573.1.
    AC112504 Genomic DNA. No translation available.
    BC011835 mRNA. Translation: AAH11835.1.
    CCDSiCCDS3121.1.
    PIRiG02485.
    RefSeqiNP_001670.1. NM_001679.2.
    UniGeneiHs.477789.

    Genome annotation databases

    EnsembliENST00000286371; ENSP00000286371; ENSG00000069849.
    ENST00000539728; ENSP00000440307; ENSG00000069849.
    GeneIDi483.
    KEGGihsa:483.
    UCSCiuc003eug.1. human.

    Polymorphism databases

    DMDMi1703470.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U51478 mRNA. Translation: AAC50665.1 .
    AF005896
    , AF005890 , AF005891 , AF005892 , AF005893 , AF005894 , AF005895 Genomic DNA. Translation: AAB61713.1 .
    AK293697 mRNA. Translation: BAH11573.1 .
    AC112504 Genomic DNA. No translation available.
    BC011835 mRNA. Translation: AAH11835.1 .
    CCDSi CCDS3121.1.
    PIRi G02485.
    RefSeqi NP_001670.1. NM_001679.2.
    UniGenei Hs.477789.

    3D structure databases

    ProteinModelPortali P54709.
    SMRi P54709. Positions 16-279.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 106973. 8 interactions.
    IntActi P54709. 4 interactions.
    MINTi MINT-5001083.
    STRINGi 9606.ENSP00000286371.

    Chemistry

    BindingDBi P54709.
    ChEMBLi CHEMBL2095186.

    Protein family/group databases

    TCDBi 3.A.3.1.1. the p-type atpase (p-atpase) superfamily.

    PTM databases

    PhosphoSitei P54709.

    Polymorphism databases

    DMDMi 1703470.

    Proteomic databases

    MaxQBi P54709.
    PaxDbi P54709.
    PRIDEi P54709.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000286371 ; ENSP00000286371 ; ENSG00000069849 .
    ENST00000539728 ; ENSP00000440307 ; ENSG00000069849 .
    GeneIDi 483.
    KEGGi hsa:483.
    UCSCi uc003eug.1. human.

    Organism-specific databases

    CTDi 483.
    GeneCardsi GC03P141594.
    HGNCi HGNC:806. ATP1B3.
    HPAi CAB020697.
    MIMi 601867. gene.
    neXtProti NX_P54709.
    PharmGKBi PA68.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG263581.
    HOGENOMi HOG000039248.
    HOVERGENi HBG050603.
    InParanoidi P54709.
    KOi K01540.
    OMAi LMISPKP.
    PhylomeDBi P54709.
    TreeFami TF314618.

    Enzyme and pathway databases

    Reactomei REACT_12560. Basigin interactions.
    REACT_25149. Ion transport by P-type ATPases.

    Miscellaneous databases

    GeneWikii ATP1B3.
    GenomeRNAii 483.
    NextBioi 2005.
    PROi P54709.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P54709.
    Bgeei P54709.
    CleanExi HS_ATP1B3.
    Genevestigatori P54709.

    Family and domain databases

    InterProi IPR000402. Na/K_ATPase_sub_beta.
    [Graphical view ]
    PANTHERi PTHR11523. PTHR11523. 1 hit.
    Pfami PF00287. Na_K-ATPase. 1 hit.
    [Graphical view ]
    TIGRFAMsi TIGR01107. Na_K_ATPase_bet. 1 hit.
    PROSITEi PS00390. ATPASE_NA_K_BETA_1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Placenta.
    2. "Structural organization and chromosomal localization of the human Na,K- ATPase beta 3 subunit gene and pseudogene."
      Malik N., Canfield V., Sanchez-Watts G., Watts A.G., Scherer S., Beatty B.G., Gros P., Levenson R.
      Mamm. Genome 9:136-143(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Cerebellum.
    4. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.
    6. "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry."
      Zhang H., Li X.-J., Martin D.B., Aebersold R.
      Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION AT ASN-240.
    7. Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS].
      Tissue: Melanoma.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiAT1B3_HUMAN
    AccessioniPrimary (citable) accession number: P54709
    Secondary accession number(s): B7Z1N7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: October 1, 1996
    Last modified: October 1, 2014
    This is version 128 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3