Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

CACNB2

Organism
Oryctolagus cuniculus (Rabbit)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei521 – 5211Required for CaMK2D-bindingBy similarity

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Calcium channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

Calcium

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
Gene namesi
Name:CACNB2
Synonyms:CACNLB2
OrganismiOryctolagus cuniculus (Rabbit)
Taxonomic identifieri9986 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresLagomorphaLeporidaeOryctolagus
Proteomesi
  • UP000001811 Componenti: Unplaced

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 632632Voltage-dependent L-type calcium channel subunit beta-2PRO_0000144053Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei176 – 1761PhosphoserineBy similarity
Modified residuei179 – 1791PhosphoserineBy similarity
Modified residuei190 – 1901PhosphoserineBy similarity
Modified residuei522 – 5221PhosphoserineBy similarity
Modified residuei526 – 5261Phosphothreonine; by CaMK2DBy similarity

Post-translational modificationi

Regulated through phosphorylation at Thr-526 by CaMK2D.By similarity

Keywords - PTMi

Phosphoprotein

PTM databases

iPTMnetiP54288.

Expressioni

Tissue specificityi

Predominantly expressed in heart, aorta and brain.

Interactioni

Subunit structurei

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane. Interacts with CAMK2D. Interacts with CBARP (By similarity).By similarity

Protein-protein interaction databases

STRINGi9986.ENSOCUP00000021223.

Structurei

Secondary structure

1
632
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi64 – 663Combined sources
Helixi67 – 8115Combined sources
Beta strandi83 – 853Combined sources
Beta strandi89 – 957Combined sources
Helixi101 – 1033Combined sources
Beta strandi119 – 1257Combined sources
Beta strandi127 – 13711Combined sources
Beta strandi143 – 1464Combined sources
Helixi148 – 16114Combined sources
Beta strandi220 – 2245Combined sources
Beta strandi230 – 2334Combined sources
Beta strandi246 – 2505Combined sources
Beta strandi256 – 2594Combined sources
Helixi267 – 28317Combined sources
Turni284 – 2863Combined sources
Beta strandi287 – 2937Combined sources
Helixi297 – 2993Combined sources
Helixi302 – 3054Combined sources
Helixi312 – 3154Combined sources
Beta strandi316 – 3216Combined sources
Helixi323 – 33614Combined sources
Turni337 – 3393Combined sources
Beta strandi342 – 3476Combined sources
Helixi353 – 3553Combined sources
Turni356 – 3583Combined sources
Helixi359 – 3624Combined sources
Beta strandi364 – 3685Combined sources
Helixi373 – 3819Combined sources
Helixi385 – 3884Combined sources
Helixi391 – 40313Combined sources
Helixi406 – 4083Combined sources
Beta strandi410 – 4134Combined sources
Helixi418 – 43619Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1T3LX-ray2.20A51-163[»]
A229-448[»]
1T3SX-ray2.30A51-163[»]
A203-422[»]
4DEXX-ray2.00A51-163[»]
A229-448[»]
4DEYX-ray1.95A51-163[»]
A229-448[»]
ProteinModelPortaliP54288.
SMRiP54288. Positions 60-437.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP54288.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini86 – 14762SH3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiP54288.
KOiK04863.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTiSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2B (identifier: P54288-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNQASGLDLL KISYGKGARR KNRFKGSDGS TSSDTTSNSF VRQGSADSYT
60 70 80 90 100
SRPSDSDVSL EEDREAVRRE AERQAQAQLE KAKTKPVAFA VRTNVSYSAA
110 120 130 140 150
HEDDVPVPGM AISFEAKDFL HVKEKFNNDW WIGRLVKEGC EIGFIPSPVK
160 170 180 190 200
LENMRLQHEQ RAKQGKFYSS KSGGNSSSSL GDIVPSSRKS TPPSSAIDID
210 220 230 240 250
ATGLDAEEND IPANHRSPKP SANSVTSPHS KEKRMPFFKK TEHTPPYDVV
260 270 280 290 300
PSMRPVVLVG PSLKGYEVTD MMQKALFDFL KHRFEGRISI TRVTADISLA
310 320 330 340 350
KRSVLNNPSK HAIIERSNTR SSLAEVQSEI ERIFELARTL QLVVLDADTI
360 370 380 390 400
NHPAQLSKTS LAPIVVYVKI SSPKVLQRLI KSRGKSQAKH LNVQMVAADK
410 420 430 440 450
LAQCPPELFD VILDENQLED ACEHLADYLE AYWKATHPPS SNLPNPLLSR
460 470 480 490 500
TLATSALPVS PTLASNSQGS QGDQRTDRSA PARSASQAEE EPCLEPAKKS
510 520 530 540 550
QHRSSSSAPH HNHRSGTSRG LSRQETFDSE TQESRDSAYV EPKEDYSHEH
560 570 580 590 600
VDHYAPHRDH NHRDETHRSS DHRHRETRHR SRDMDREQDH NECNKQRSRH
610 620 630
KSKDRYCDKD GEVISKKRNE AGEWNRDVYI RQ
Length:632
Mass (Da):70,944
Last modified:October 1, 1996 - v1
Checksum:iEB6873D1F8DEB5D4
GO
Isoform 2A (identifier: P54288-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MNQASGLDLLKISYGKGARRKNRFKGSDGSTSSDTTSNSFVRQ → MLDRHLAAPHTQGLVLE

Show »
Length:606
Mass (Da):68,178
Checksum:i55534DED1FD2F804
GO
Isoform 2C (identifier: P54288-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     197-240: IDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → KQKQKS

Show »
Length:594
Mass (Da):66,812
Checksum:i3E0705B34B1B7C65
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4343MNQAS…SFVRQ → MLDRHLAAPHTQGLVLE in isoform 2A. 1 PublicationVSP_000632Add
BLAST
Alternative sequencei197 – 24044IDIDA…PFFKK → KQKQKS in isoform 2C. 1 PublicationVSP_000633Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X64298 mRNA. Translation: CAA45576.1.
X64297 mRNA. Translation: CAA45575.1.
X64299 mRNA. Translation: CAA45577.1.
PIRiS21046.
S21048.
RefSeqiNP_001075865.1. NM_001082396.1. [P54288-1]
UniGeneiOcu.2071.

Genome annotation databases

GeneIDi100009277.
KEGGiocu:100009277.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X64298 mRNA. Translation: CAA45576.1.
X64297 mRNA. Translation: CAA45575.1.
X64299 mRNA. Translation: CAA45577.1.
PIRiS21046.
S21048.
RefSeqiNP_001075865.1. NM_001082396.1. [P54288-1]
UniGeneiOcu.2071.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1T3LX-ray2.20A51-163[»]
A229-448[»]
1T3SX-ray2.30A51-163[»]
A203-422[»]
4DEXX-ray2.00A51-163[»]
A229-448[»]
4DEYX-ray1.95A51-163[»]
A229-448[»]
ProteinModelPortaliP54288.
SMRiP54288. Positions 60-437.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9986.ENSOCUP00000021223.

PTM databases

iPTMnetiP54288.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi100009277.
KEGGiocu:100009277.

Organism-specific databases

CTDi783.

Phylogenomic databases

eggNOGiKOG3812. Eukaryota.
ENOG410XRDI. LUCA.
HOGENOMiHOG000230979.
HOVERGENiHBG050765.
InParanoidiP54288.
KOiK04863.

Miscellaneous databases

EvolutionaryTraceiP54288.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR005444. VDCC_L_b2su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERiPTHR11824. PTHR11824. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSiPR01626. LCACHANNELB.
PR01628. LCACHANNELB2.
SMARTiSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCACB2_RABIT
AccessioniPrimary (citable) accession number: P54288
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: July 6, 2016
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.