Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P54284 (CACB3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 139. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Voltage-dependent L-type calcium channel subunit beta-3

Short name=CAB3
Alternative name(s):
Calcium channel voltage-dependent subunit beta 3
Gene names
Name:CACNB3
Synonyms:CACNLB3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length484 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Subunit structure

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with CACNA2D4. Interacts with FASLG. Ref.9 Ref.10

Tissue specificity

Expressed mostly in brain, smooth muscle and ovary.

Sequence similarities

Belongs to the calcium channel beta subunit family.

Contains 1 SH3 domain.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P54284-1)

Also known as: 3A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P54284-2)

Also known as: 3B;

The sequence of this isoform differs from the canonical sequence as follows:
     440-484: HRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY → QCQLLSLL
Isoform 3 (identifier: P54284-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MYDDSYVPGFEDSEA → ME
Note: No experimental confirmation available.
Isoform 4 (identifier: P54284-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MYDDSYVPGFEDSEA → MSFSDSSATFLLNE
Note: No experimental confirmation available.
Isoform 5 (identifier: P54284-5)

The sequence of this isoform differs from the canonical sequence as follows:
     57-97: Missing.
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 484484Voltage-dependent L-type calcium channel subunit beta-3
PRO_0000144056

Regions

Domain59 – 12062SH3

Natural variations

Alternative sequence1 – 1515MYDDS…EDSEA → ME in isoform 3.
VSP_046708
Alternative sequence1 – 1515MYDDS…EDSEA → MSFSDSSATFLLNE in isoform 4.
VSP_046709
Alternative sequence57 – 9741Missing in isoform 5.
VSP_046710
Alternative sequence440 – 48445HRQHT…PKDSY → QCQLLSLL in isoform 2.
VSP_000634
Natural variant4231R → H.
Corresponds to variant rs2229954 [ dbSNP | Ensembl ].
VAR_024384

Experimental info

Sequence conflict71V → L in AAA19799. Ref.4
Sequence conflict321Missing in AAA19799. Ref.4
Sequence conflict601V → E in AAA19799. Ref.4
Sequence conflict1011N → D in BAH14694. Ref.5
Sequence conflict1621Q → R in BAH14209. Ref.5
Sequence conflict1961M → T in BAH12637. Ref.5
Sequence conflict2451S → P in BAH12637. Ref.5
Sequence conflict3201Missing in AAA19799. Ref.4
Sequence conflict3481H → L in AAA19799. Ref.4
Sequence conflict4211S → T in AAA19799. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (3A) [UniParc].

Last modified October 1, 1996. Version 1.
Checksum: 19CD3549F5A8E17A

FASTA48454,532
        10         20         30         40         50         60 
MYDDSYVPGF EDSEAGSADS YTSRPSLDSD VSLEEDRESA RREVESQAQQ QLERAKHKPV 

        70         80         90        100        110        120 
AFAVRTNVSY CGVLDEECPV QGSGVNFEAK DFLHIKEKYS NDWWIGRLVK EGGDIAFIPS 

       130        140        150        160        170        180 
PQRLESIRLK QEQKARRSGN PSSLSDIGNR RSPPPSLAKQ KQKQAEHVPP YDVVPSMRPV 

       190        200        210        220        230        240 
VLVGPSLKGY EVTDMMQKAL FDFLKHRFDG RISITRVTAD LSLAKRSVLN NPGKRTIIER 

       250        260        270        280        290        300 
SSARSSIAEV QSEIERIFEL AKSLQLVVLD ADTINHPAQL AKTSLAPIIV FVKVSSPKVL 

       310        320        330        340        350        360 
QRLIRSRGKS QMKHLTVQMM AYDKLVQCPP ESFDVILDEN QLEDACEHLA EYLEVYWRAT 

       370        380        390        400        410        420 
HHPAPGPGLL GPPSAIPGLQ NQQLLGERGE EHSPLERDSL MPSDEASESS RQAWTGSSQR 

       430        440        450        460        470        480 
SSRHLEEDYA DAYQDLYQPH RQHTSGLPSA NGHDPQDRLL AQDSEHNHSD RNWQRNRPWP 


KDSY 

« Hide

Isoform 2 (3B) [UniParc].

Checksum: C2BCB90B9B4FEB3F
Show »

FASTA44750,106
Isoform 3 [UniParc].

Checksum: 37BA075B29E7A52C
Show »

FASTA47153,085
Isoform 4 [UniParc].

Checksum: C979431C760076AF
Show »

FASTA48354,356
Isoform 5 [UniParc].

Checksum: 6A689973F8712530
Show »

FASTA44350,015

References

« Hide 'large scale' references
[1]Murakami M., Klugbauer N., Flockerzi V.
Submitted (DEC-1993) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
[2]"The structures of the human calcium channel alpha 1 subunit (CACNL1A2) and beta subunit (CACNLB3) genes."
Yamada Y., Masuda K., Li Q., Ihara Y., Kubota A., Miura T., Nakamura K., Fujii Y., Seino S., Seino Y.
Genomics 27:312-319(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[3]Furneaux H.M.
Submitted (FEB-1994) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Fetal brain.
[4]"Cloning, chromosomal location and functional expression of the human voltage-dependent calcium-channel beta 3 subunit."
Collin T., Lory P., Taviaux S., Courtieu C., Guilbault P., Berta P., Nargeot J.
Eur. J. Biochem. 220:257-262(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
Tissue: Brain, Small intestine and Uterus.
[6]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[9]"Molecular cloning and characterization of the human voltage-gated calcium channel alpha(2)delta-4 subunit."
Qin N., Yagel S., Momplaisir M.-L., Codd E.E., D'Andrea M.R.
Mol. Pharmacol. 62:485-496(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH CACNA2D4.
[10]"Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
Voss M., Lettau M., Janssen O.
BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH FASLG.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X76555 mRNA. Translation: CAA54055.1.
X76556 mRNA. Translation: CAA54056.1.
D43704 Genomic DNA. Translation: BAA07803.1.
U07139 mRNA. Translation: AAA95958.1.
L27584 mRNA. Translation: AAA19799.1.
AK289709 mRNA. Translation: BAF82398.1.
AK297639 mRNA. Translation: BAH12637.1.
AK304537 mRNA. Translation: BAH14209.1.
AK316323 mRNA. Translation: BAH14694.1.
AC117498 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58008.1.
BC041811 mRNA. Translation: AAH41811.1.
CCDSCCDS55821.1. [P54284-3]
CCDS55822.1. [P54284-4]
CCDS55823.1. [P54284-5]
CCDS8769.1. [P54284-1]
PIRS39315.
S39316.
S41211.
RefSeqNP_000716.2. NM_000725.3. [P54284-1]
NP_001193844.1. NM_001206915.1. [P54284-5]
NP_001193845.1. NM_001206916.1. [P54284-4]
NP_001193846.1. NM_001206917.1. [P54284-3]
UniGeneHs.250712.
Hs.737291.

3D structure databases

ProteinModelPortalP54284.
SMRP54284. Positions 1-362.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107238. 2 interactions.
DIPDIP-39138N.
IntActP54284. 2 interactions.
STRING9606.ENSP00000301050.

Chemistry

ChEMBLCHEMBL2363032.
DrugBankDB00661. Verapamil.

Protein family/group databases

TCDB8.A.22.1.3. the ca(2+) channel auxiliary subunit types 1-4 (cca-) family.

PTM databases

PhosphoSiteP54284.

Polymorphism databases

DMDM1705683.

Proteomic databases

MaxQBP54284.
PaxDbP54284.
PRIDEP54284.

Protocols and materials databases

DNASU784.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000301050; ENSP00000301050; ENSG00000167535. [P54284-1]
ENST00000536187; ENSP00000444160; ENSG00000167535. [P54284-4]
ENST00000540990; ENSP00000445495; ENSG00000167535. [P54284-3]
ENST00000547230; ENSP00000448304; ENSG00000167535. [P54284-5]
GeneID784.
KEGGhsa:784.
UCSCuc001rsk.2. human. [P54284-1]

Organism-specific databases

CTD784.
GeneCardsGC12P049212.
HGNCHGNC:1403. CACNB3.
MIM601958. gene.
neXtProtNX_P54284.
PharmGKBPA89.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG326500.
HOGENOMHOG000230979.
HOVERGENHBG050765.
InParanoidP54284.
KOK04864.
OMAPPMQGGR.
PhylomeDBP54284.
TreeFamTF316195.

Enzyme and pathway databases

ReactomeREACT_111045. Developmental Biology.
REACT_111217. Metabolism.
REACT_13685. Neuronal System.

Gene expression databases

ArrayExpressP54284.
BgeeP54284.
CleanExHS_CACNB3.
GenevestigatorP54284.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR008145. GK/Ca_channel_bsu.
IPR027417. P-loop_NTPase.
IPR001452. SH3_domain.
IPR008079. VDCC_L_b3su.
IPR000584. VDCC_L_bsu.
[Graphical view]
PANTHERPTHR11824. PTHR11824. 1 hit.
PfamPF00625. Guanylate_kin. 1 hit.
PF12052. VGCC_beta4Aa_N. 1 hit.
[Graphical view]
PRINTSPR01626. LCACHANNELB.
PR01696. LCACHANNELB3.
SMARTSM00072. GuKc. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF50044. SSF50044. 1 hit.
SSF52540. SSF52540. 1 hit.
ProtoNetSearch...

Other

GeneWikiCACNB3.
GenomeRNAi784.
NextBio3190.
PROP54284.
SOURCESearch...

Entry information

Entry nameCACB3_HUMAN
AccessionPrimary (citable) accession number: P54284
Secondary accession number(s): A8K0Z4 expand/collapse secondary AC list , B7Z4Q1, B7Z973, B7ZAK8, F5GZW7, F5H2P6, F8VSG3, Q13913
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: July 9, 2014
This is version 139 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM