P54284 (CACB3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Voltage-dependent L-type calcium channel subunit beta-3 Short name=CAB3 Alternative name(s): Calcium channel voltage-dependent subunit beta 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 484 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. |
| Subunit structure | The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with CACNA2D4. Interacts with FASLG. Ref.8 Ref.9 |
| Tissue specificity | Expressed mostly in brain, smooth muscle and ovary. |
| Sequence similarities | Belongs to the calcium channel beta subunit family. Contains 1 SH3 domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Calcium transport Ion transport Transport |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | SH3 domain |
| Ligand | Calcium |
| Molecular function | Calcium channel Ion channel Voltage-gated channel |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | T cell receptor signaling pathway Inferred from electronic annotation. Source: Compara axon guidanceTraceable author statement. Source: Reactome membrane depolarizationTraceable author statement. Source: Reactome synaptic transmissionTraceable author statement. Source: Reactome |
| Cellular_component | apical plasma membrane Inferred from electronic annotation. Source: Compara cytosolTraceable author statement. Source: Reactome voltage-gated calcium channel complexInferred from direct assay PubMed 11160515. Source: UniProtKB |
| Molecular_function | voltage-gated calcium channel activity Traceable author statement Ref.4. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3A (identifier: P54284-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 3B (identifier: P54284-2) The sequence of this isoform differs from the canonical sequence as follows: 440-484: HRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY → QCQLLSLL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 484 | 484 | Voltage-dependent L-type calcium channel subunit beta-3 | PRO_0000144056 | |||||
Regions | |||||||||
| Domain | 59 – 120 | 62 | SH3 | ||||||
Natural variations | |||||||||
| Alternative sequence | 440 – 484 | 45 | HRQHT…PKDSY → QCQLLSLL in isoform 3B. | VSP_000634 | |||||
| Natural variant | 423 | 1 | R → H. Corresponds to variant rs2229954 [ dbSNP | Ensembl ]. | VAR_024384 | |||||
Experimental info | |||||||||
| Sequence conflict | 7 | 1 | V → L in AAA19799. Ref.4 | ||||||
| Sequence conflict | 32 | 1 | Missing in AAA19799. Ref.4 | ||||||
| Sequence conflict | 60 | 1 | V → E in AAA19799. Ref.4 | ||||||
| Sequence conflict | 320 | 1 | Missing in AAA19799. Ref.4 | ||||||
| Sequence conflict | 348 | 1 | H → L in AAA19799. Ref.4 | ||||||
| Sequence conflict | 421 | 1 | S → T in AAA19799. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Murakami M., Klugbauer N., Flockerzi V. Submitted (DEC-1993) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3A AND 3B). |
| [2] | "The structures of the human calcium channel alpha 1 subunit (CACNL1A2) and beta subunit (CACNLB3) genes." Yamada Y., Masuda K., Li Q., Ihara Y., Kubota A., Miura T., Nakamura K., Fujii Y., Seino S., Seino Y. Genomics 27:312-319(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | Furneaux H.M. Submitted (FEB-1994) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3A). Tissue: Fetal brain. |
| [4] | "Cloning, chromosomal location and functional expression of the human voltage-dependent calcium-channel beta 3 subunit." Collin T., Lory P., Taviaux S., Courtieu C., Guilbault P., Berta P., Nargeot J. Eur. J. Biochem. 220:257-262(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3A). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3A). Tissue: Brain. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3A). Tissue: Brain. |
| [8] | "Molecular cloning and characterization of the human voltage-gated calcium channel alpha(2)delta-4 subunit." Qin N., Yagel S., Momplaisir M.-L., Codd E.E., D'Andrea M.R. Mol. Pharmacol. 62:485-496(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CACNA2D4. |
| [9] | "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening." Voss M., Lettau M., Janssen O. BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FASLG. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X76555 mRNA. Translation: CAA54055.1. X76556 mRNA. Translation: CAA54056.1. D43704 Genomic DNA. Translation: BAA07803.1. U07139 mRNA. Translation: AAA95958.1. L27584 mRNA. Translation: AAA19799.1. AK289709 mRNA. Translation: BAF82398.1. CH471111 Genomic DNA. Translation: EAW58008.1. BC041811 mRNA. Translation: AAH41811.1. |
| IPI | IPI00005567. IPI00031790. |
| PIR | S39315. S39316. S41211. |
| RefSeq | NP_000716.2. NM_000725.3. |
| UniGene | Hs.250712. Hs.737291. |
3D structure databases | |
| ProteinModelPortal | P54284. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-39138N. |
| IntAct | P54284. 2 interactions. |
| STRING | 9606.ENSP00000301050. |
Protein family/group databases | |
| TCDB | 8.A.22.3.1. Ca2+ channel auxiliary subunit beta types 1-4 (CCA-beta) family. |
PTM databases | |
| PhosphoSite | P54284. |
Polymorphism databases | |
| DMDM | 1705683. |
Proteomic databases | |
| PaxDb | P54284. |
| PRIDE | P54284. |
Protocols and materials databases | |
| DNASU | 784. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000301050; ENSP00000301050; ENSG00000167535. |
| GeneID | 784. |
| KEGG | hsa:784. |
| UCSC | uc001rsk.2. human. |
Organism-specific databases | |
| CTD | 784. |
| GeneCards | GC12P049212. |
| HGNC | HGNC:1403. CACNB3. |
| MIM | 601958. gene. |
| neXtProt | NX_P54284. |
| PharmGKB | PA89. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG326500. |
| HOGENOM | HOG000230979. |
| HOVERGEN | HBG050765. |
| InParanoid | P54284. |
| KO | K04864. |
| OMA | LATPPNK. |
| OrthoDB | EOG469QTZ. |
Enzyme and pathway databases | |
| Reactome | REACT_111045. Developmental Biology. REACT_111217. Metabolism. REACT_13685. Neuronal System. |
Gene expression databases | |
| ArrayExpress | P54284. |
| Bgee | P54284. |
| CleanEx | HS_CACNB3. |
| Genevestigator | P54284. |
| GermOnline | ENSG00000167535. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR001452. SH3_domain. IPR008079. VDCC_L_b3su. IPR000584. VDCC_L_bsu. [Graphical view] |
| PANTHER | PTHR11824. PTHR11824. 1 hit. |
| Pfam | PF00625. Guanylate_kin. 1 hit. PF12052. VGCC_beta4Aa_N. 1 hit. [Graphical view] |
| PRINTS | PR01626. LCACHANNELB. PR01696. LCACHANNELB3. |
| SMART | SM00072. GuKc. 1 hit. SM00326. SH3. 1 hit. [Graphical view] |
| SUPFAM | SSF50044. SH3. 1 hit. |
| PROSITE | PS50002. SH3. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00661. Verapamil. |
| GenomeRNAi | 784. |
| NextBio | 3190. |
| SOURCE | Search... |
Entry information
| Entry name | CACB3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P54284 Secondary accession number(s): A8K0Z4, Q13913 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
