Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P54284

- CACB3_HUMAN

UniProt

P54284 - CACB3_HUMAN

Protein

Voltage-dependent L-type calcium channel subunit beta-3

Gene

CACNB3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 141 (01 Oct 2014)
      Sequence version 1 (01 Oct 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

    GO - Molecular functioni

    1. voltage-gated calcium channel activity Source: ProtInc

    GO - Biological processi

    1. axon guidance Source: Reactome
    2. calcium ion transport Source: UniProtKB
    3. membrane depolarization Source: Reactome
    4. synaptic transmission Source: Reactome
    5. T cell receptor signaling pathway Source: Ensembl
    6. transport Source: ProtInc

    Keywords - Molecular functioni

    Calcium channel, Ion channel, Voltage-gated channel

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    ReactomeiREACT_13606. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.
    REACT_18312. NCAM1 interactions.
    REACT_18325. Regulation of insulin secretion.
    REACT_18339. Adrenaline,noradrenaline inhibits insulin secretion.

    Protein family/group databases

    TCDBi8.A.22.1.3. the ca(2+) channel auxiliary subunit types 1-4 (cca-) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Voltage-dependent L-type calcium channel subunit beta-3
    Short name:
    CAB3
    Alternative name(s):
    Calcium channel voltage-dependent subunit beta 3
    Gene namesi
    Name:CACNB3
    Synonyms:CACNLB3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:1403. CACNB3.

    Subcellular locationi

    GO - Cellular componenti

    1. apical plasma membrane Source: Ensembl
    2. cytosol Source: Reactome
    3. membrane Source: UniProtKB
    4. voltage-gated calcium channel complex Source: UniProtKB

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA89.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 484484Voltage-dependent L-type calcium channel subunit beta-3PRO_0000144056Add
    BLAST

    Proteomic databases

    MaxQBiP54284.
    PaxDbiP54284.
    PRIDEiP54284.

    PTM databases

    PhosphoSiteiP54284.

    Expressioni

    Tissue specificityi

    Expressed mostly in brain, smooth muscle and ovary.

    Gene expression databases

    ArrayExpressiP54284.
    BgeeiP54284.
    CleanExiHS_CACNB3.
    GenevestigatoriP54284.

    Interactioni

    Subunit structurei

    The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with CACNA2D4. Interacts with FASLG.2 Publications

    Protein-protein interaction databases

    BioGridi107238. 2 interactions.
    DIPiDIP-39138N.
    IntActiP54284. 2 interactions.
    STRINGi9606.ENSP00000301050.

    Structurei

    3D structure databases

    ProteinModelPortaliP54284.
    SMRiP54284. Positions 1-362.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini59 – 12062SH3Add
    BLAST

    Sequence similaritiesi

    Contains 1 SH3 domain.Curated

    Keywords - Domaini

    SH3 domain

    Phylogenomic databases

    eggNOGiNOG326500.
    HOGENOMiHOG000230979.
    HOVERGENiHBG050765.
    InParanoidiP54284.
    KOiK04864.
    OMAiPPMQGGR.
    PhylomeDBiP54284.
    TreeFamiTF316195.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR008145. GK/Ca_channel_bsu.
    IPR027417. P-loop_NTPase.
    IPR001452. SH3_domain.
    IPR008079. VDCC_L_b3su.
    IPR000584. VDCC_L_bsu.
    [Graphical view]
    PANTHERiPTHR11824. PTHR11824. 1 hit.
    PfamiPF00625. Guanylate_kin. 1 hit.
    PF12052. VGCC_beta4Aa_N. 1 hit.
    [Graphical view]
    PRINTSiPR01626. LCACHANNELB.
    PR01696. LCACHANNELB3.
    SMARTiSM00072. GuKc. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 1 hit.
    SSF52540. SSF52540. 1 hit.

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P54284-1) [UniParc]FASTAAdd to Basket

    Also known as: 3A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYDDSYVPGF EDSEAGSADS YTSRPSLDSD VSLEEDRESA RREVESQAQQ    50
    QLERAKHKPV AFAVRTNVSY CGVLDEECPV QGSGVNFEAK DFLHIKEKYS 100
    NDWWIGRLVK EGGDIAFIPS PQRLESIRLK QEQKARRSGN PSSLSDIGNR 150
    RSPPPSLAKQ KQKQAEHVPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL 200
    FDFLKHRFDG RISITRVTAD LSLAKRSVLN NPGKRTIIER SSARSSIAEV 250
    QSEIERIFEL AKSLQLVVLD ADTINHPAQL AKTSLAPIIV FVKVSSPKVL 300
    QRLIRSRGKS QMKHLTVQMM AYDKLVQCPP ESFDVILDEN QLEDACEHLA 350
    EYLEVYWRAT HHPAPGPGLL GPPSAIPGLQ NQQLLGERGE EHSPLERDSL 400
    MPSDEASESS RQAWTGSSQR SSRHLEEDYA DAYQDLYQPH RQHTSGLPSA 450
    NGHDPQDRLL AQDSEHNHSD RNWQRNRPWP KDSY 484
    Length:484
    Mass (Da):54,532
    Last modified:October 1, 1996 - v1
    Checksum:i19CD3549F5A8E17A
    GO
    Isoform 2 (identifier: P54284-2) [UniParc]FASTAAdd to Basket

    Also known as: 3B

    The sequence of this isoform differs from the canonical sequence as follows:
         440-484: HRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY → QCQLLSLL

    Show »
    Length:447
    Mass (Da):50,106
    Checksum:iC2BCB90B9B4FEB3F
    GO
    Isoform 3 (identifier: P54284-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-15: MYDDSYVPGFEDSEA → ME

    Note: No experimental confirmation available.

    Show »
    Length:471
    Mass (Da):53,085
    Checksum:i37BA075B29E7A52C
    GO
    Isoform 4 (identifier: P54284-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-15: MYDDSYVPGFEDSEA → MSFSDSSATFLLNE

    Note: No experimental confirmation available.

    Show »
    Length:483
    Mass (Da):54,356
    Checksum:iC979431C760076AF
    GO
    Isoform 5 (identifier: P54284-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         57-97: Missing.

    Note: Gene prediction based on EST data.

    Show »
    Length:443
    Mass (Da):50,015
    Checksum:i6A689973F8712530
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti7 – 71V → L in AAA19799. (PubMed:8119293)Curated
    Sequence conflicti32 – 321Missing in AAA19799. (PubMed:8119293)Curated
    Sequence conflicti60 – 601V → E in AAA19799. (PubMed:8119293)Curated
    Sequence conflicti101 – 1011N → D in BAH14694. (PubMed:14702039)Curated
    Sequence conflicti162 – 1621Q → R in BAH14209. (PubMed:14702039)Curated
    Sequence conflicti196 – 1961M → T in BAH12637. (PubMed:14702039)Curated
    Sequence conflicti245 – 2451S → P in BAH12637. (PubMed:14702039)Curated
    Sequence conflicti320 – 3201Missing in AAA19799. (PubMed:8119293)Curated
    Sequence conflicti348 – 3481H → L in AAA19799. (PubMed:8119293)Curated
    Sequence conflicti421 – 4211S → T in AAA19799. (PubMed:8119293)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti423 – 4231R → H.
    Corresponds to variant rs2229954 [ dbSNP | Ensembl ].
    VAR_024384

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1515MYDDS…EDSEA → ME in isoform 3. 1 PublicationVSP_046708Add
    BLAST
    Alternative sequencei1 – 1515MYDDS…EDSEA → MSFSDSSATFLLNE in isoform 4. 1 PublicationVSP_046709Add
    BLAST
    Alternative sequencei57 – 9741Missing in isoform 5. CuratedVSP_046710Add
    BLAST
    Alternative sequencei440 – 48445HRQHT…PKDSY → QCQLLSLL in isoform 2. 1 PublicationVSP_000634Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X76555 mRNA. Translation: CAA54055.1.
    X76556 mRNA. Translation: CAA54056.1.
    D43704 Genomic DNA. Translation: BAA07803.1.
    U07139 mRNA. Translation: AAA95958.1.
    L27584 mRNA. Translation: AAA19799.1.
    AK289709 mRNA. Translation: BAF82398.1.
    AK297639 mRNA. Translation: BAH12637.1.
    AK304537 mRNA. Translation: BAH14209.1.
    AK316323 mRNA. Translation: BAH14694.1.
    AC117498 Genomic DNA. No translation available.
    CH471111 Genomic DNA. Translation: EAW58008.1.
    BC041811 mRNA. Translation: AAH41811.1.
    CCDSiCCDS55821.1. [P54284-3]
    CCDS55822.1. [P54284-4]
    CCDS55823.1. [P54284-5]
    CCDS8769.1. [P54284-1]
    PIRiS39315.
    S39316.
    S41211.
    RefSeqiNP_000716.2. NM_000725.3. [P54284-1]
    NP_001193844.1. NM_001206915.1. [P54284-5]
    NP_001193845.1. NM_001206916.1. [P54284-4]
    NP_001193846.1. NM_001206917.1. [P54284-3]
    UniGeneiHs.250712.
    Hs.737291.

    Genome annotation databases

    EnsembliENST00000301050; ENSP00000301050; ENSG00000167535. [P54284-1]
    ENST00000536187; ENSP00000444160; ENSG00000167535. [P54284-4]
    ENST00000540990; ENSP00000445495; ENSG00000167535. [P54284-3]
    ENST00000547230; ENSP00000448304; ENSG00000167535. [P54284-5]
    GeneIDi784.
    KEGGihsa:784.
    UCSCiuc001rsk.2. human. [P54284-1]

    Polymorphism databases

    DMDMi1705683.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X76555 mRNA. Translation: CAA54055.1 .
    X76556 mRNA. Translation: CAA54056.1 .
    D43704 Genomic DNA. Translation: BAA07803.1 .
    U07139 mRNA. Translation: AAA95958.1 .
    L27584 mRNA. Translation: AAA19799.1 .
    AK289709 mRNA. Translation: BAF82398.1 .
    AK297639 mRNA. Translation: BAH12637.1 .
    AK304537 mRNA. Translation: BAH14209.1 .
    AK316323 mRNA. Translation: BAH14694.1 .
    AC117498 Genomic DNA. No translation available.
    CH471111 Genomic DNA. Translation: EAW58008.1 .
    BC041811 mRNA. Translation: AAH41811.1 .
    CCDSi CCDS55821.1. [P54284-3 ]
    CCDS55822.1. [P54284-4 ]
    CCDS55823.1. [P54284-5 ]
    CCDS8769.1. [P54284-1 ]
    PIRi S39315.
    S39316.
    S41211.
    RefSeqi NP_000716.2. NM_000725.3. [P54284-1 ]
    NP_001193844.1. NM_001206915.1. [P54284-5 ]
    NP_001193845.1. NM_001206916.1. [P54284-4 ]
    NP_001193846.1. NM_001206917.1. [P54284-3 ]
    UniGenei Hs.250712.
    Hs.737291.

    3D structure databases

    ProteinModelPortali P54284.
    SMRi P54284. Positions 1-362.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107238. 2 interactions.
    DIPi DIP-39138N.
    IntActi P54284. 2 interactions.
    STRINGi 9606.ENSP00000301050.

    Chemistry

    ChEMBLi CHEMBL2363032.
    DrugBanki DB00661. Verapamil.

    Protein family/group databases

    TCDBi 8.A.22.1.3. the ca(2+) channel auxiliary subunit types 1-4 (cca-) family.

    PTM databases

    PhosphoSitei P54284.

    Polymorphism databases

    DMDMi 1705683.

    Proteomic databases

    MaxQBi P54284.
    PaxDbi P54284.
    PRIDEi P54284.

    Protocols and materials databases

    DNASUi 784.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000301050 ; ENSP00000301050 ; ENSG00000167535 . [P54284-1 ]
    ENST00000536187 ; ENSP00000444160 ; ENSG00000167535 . [P54284-4 ]
    ENST00000540990 ; ENSP00000445495 ; ENSG00000167535 . [P54284-3 ]
    ENST00000547230 ; ENSP00000448304 ; ENSG00000167535 . [P54284-5 ]
    GeneIDi 784.
    KEGGi hsa:784.
    UCSCi uc001rsk.2. human. [P54284-1 ]

    Organism-specific databases

    CTDi 784.
    GeneCardsi GC12P049212.
    HGNCi HGNC:1403. CACNB3.
    MIMi 601958. gene.
    neXtProti NX_P54284.
    PharmGKBi PA89.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG326500.
    HOGENOMi HOG000230979.
    HOVERGENi HBG050765.
    InParanoidi P54284.
    KOi K04864.
    OMAi PPMQGGR.
    PhylomeDBi P54284.
    TreeFami TF316195.

    Enzyme and pathway databases

    Reactomei REACT_13606. Depolarization of the Presynaptic Terminal Triggers the Opening of Calcium Channels.
    REACT_18312. NCAM1 interactions.
    REACT_18325. Regulation of insulin secretion.
    REACT_18339. Adrenaline,noradrenaline inhibits insulin secretion.

    Miscellaneous databases

    GeneWikii CACNB3.
    GenomeRNAii 784.
    NextBioi 3190.
    PROi P54284.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P54284.
    Bgeei P54284.
    CleanExi HS_CACNB3.
    Genevestigatori P54284.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR008145. GK/Ca_channel_bsu.
    IPR027417. P-loop_NTPase.
    IPR001452. SH3_domain.
    IPR008079. VDCC_L_b3su.
    IPR000584. VDCC_L_bsu.
    [Graphical view ]
    PANTHERi PTHR11824. PTHR11824. 1 hit.
    Pfami PF00625. Guanylate_kin. 1 hit.
    PF12052. VGCC_beta4Aa_N. 1 hit.
    [Graphical view ]
    PRINTSi PR01626. LCACHANNELB.
    PR01696. LCACHANNELB3.
    SMARTi SM00072. GuKc. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 1 hit.
    SSF52540. SSF52540. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. Murakami M., Klugbauer N., Flockerzi V.
      Submitted (DEC-1993) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    2. "The structures of the human calcium channel alpha 1 subunit (CACNL1A2) and beta subunit (CACNLB3) genes."
      Yamada Y., Masuda K., Li Q., Ihara Y., Kubota A., Miura T., Nakamura K., Fujii Y., Seino S., Seino Y.
      Genomics 27:312-319(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. Furneaux H.M.
      Submitted (FEB-1994) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Fetal brain.
    4. "Cloning, chromosomal location and functional expression of the human voltage-dependent calcium-channel beta 3 subunit."
      Collin T., Lory P., Taviaux S., Courtieu C., Guilbault P., Berta P., Nargeot J.
      Eur. J. Biochem. 220:257-262(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
      Tissue: Brain, Small intestine and Uterus.
    6. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    9. "Molecular cloning and characterization of the human voltage-gated calcium channel alpha(2)delta-4 subunit."
      Qin N., Yagel S., Momplaisir M.-L., Codd E.E., D'Andrea M.R.
      Mol. Pharmacol. 62:485-496(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CACNA2D4.
    10. "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
      Voss M., Lettau M., Janssen O.
      BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH FASLG.

    Entry informationi

    Entry nameiCACB3_HUMAN
    AccessioniPrimary (citable) accession number: P54284
    Secondary accession number(s): A8K0Z4
    , B7Z4Q1, B7Z973, B7ZAK8, F5GZW7, F5H2P6, F8VSG3, Q13913
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: October 1, 1996
    Last modified: October 1, 2014
    This is version 141 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3