P54252 (ATX3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 137.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ataxin-3 EC=3.4.19.12 Alternative name(s): Machado-Joseph disease protein 1 Spinocerebellar ataxia type 3 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 364 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Deubiquitinating enzyme involved in protein homeostasis maintenance, transcription, cytoskeleton regulation, myogenesis and degradation of misfolded chaperone substrates. Binds long polyubiquitin chains and trims them, while it has weak or no activity against chains of 4 or less ubiquitins. Involved in degradation of misfolded chaperone substrates via its interaction with STUB1/CHIP: recruited to monoubiquitinated STUB1/CHIP, and restricts the length of ubiquitin chain attached to STUB1/CHIP substrates and preventing further chain extension. In response to misfolded substrate ubiquitination, mediates deubiquitination of monoubiquitinated STUB1/CHIP. Interacts with key regulators of transcription and represses transcription: acts as a histone-binding protein that regulates transcription. Ref.9 Ref.10 Ref.14 |
| Catalytic activity | Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal). Ref.10 |
| Subunit structure | Interacts with STUB1/CHIP (when monoubiquitinated) By similarity. Interacts with DNA repair proteins RAD23A and RAD23B. |
| Subcellular location | Nucleus matrix. Note: Predominantly nuclear, but not exclusively, inner nuclear matrix. Ref.8 |
| Tissue specificity | Ubiquitous. |
| Domain | The UIM domains bind ubiquitin and interact with various E3 ubiquitin-protein ligase, such as STUB1/CHIP. They are essential to limit the length of ubiquitin chains By similarity. |
| Post-translational modification | Monoubiquitinated by UBE2W, possibly leading to activate the deubiquitinating enzyme activity By similarity. |
| Polymorphism | The poly-Gln region of ATXN3 is highly polymorphic (14 to 41 repeats) in the normal population and is expanded to about 55-82 repeats in spinocerebellar ataxia 3 (SCA3) patients. The MJD1a allele carries a single nucleotide substitution in codon 349 generating a stop codon instead of a Tyr. In the Japanese population, the MJD1a allele seems to be significantly associated with Gln expansion. |
| Involvement in disease | Spinocerebellar ataxia 3 (SCA3) [MIM:109150]: Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to cerebellum degeneration with variable involvement of the brainstem and spinal cord. SCA3 belongs to the autosomal dominant cerebellar ataxias type I (ADCA I) which are characterized by cerebellar ataxia in combination with additional clinical features like optic atrophy, ophthalmoplegia, bulbar and extrapyramidal signs, peripheral neuropathy and dementia. The molecular defect in SCA3 is the a CAG repeat expansion in ATX3 coding region. Longer expansions result in earlier onset and more severe clinical manifestations of the disease. |
| Sequence similarities | Contains 1 Josephin domain. Contains 3 UIM (ubiquitin-interacting motif) repeats. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| C16orf70 | Q9BSU1 | 2 | EBI-946046,EBI-946080 | |
| VCP | P55072 | 10 | EBI-946068,EBI-355164 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P54252-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P54252-2) The sequence of this isoform differs from the canonical sequence as follows: 332-364: KACSPFIMFATFTLYLTYELHVIFALHYSSFPL → DAMSEEDMLQAAVTMSLETVRNDLKTEGKK | ||||||
| Isoform 3 (identifier: P54252-3) The sequence of this isoform differs from the canonical sequence as follows: 10-64: Missing. 332-364: KACSPFIMFATFTLYLTYELHVIFALHYSSFPL → DAMSEEDMLQAAVTMSLETVRNDLKTEGKK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 364 | 364 | Ataxin-3 | PRO_0000053831 | ||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1 – 180 | 180 | Josephin | |||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 224 – 243 | 20 | UIM 1 | |||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 244 – 263 | 20 | UIM 2 | |||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 331 – 348 | 18 | UIM 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 292 – 305 | 14 | Poly-Gln | |||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 14 | 1 | Nucleophile | |||||||||||||||||||||||||||||||||||||||||||||
| Active site | 119 | 1 | Proton acceptor Probable | |||||||||||||||||||||||||||||||||||||||||||||
| Active site | 134 | 1 | Probable | |||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 219 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 10 – 64 | 55 | Missing in isoform 3. | VSP_002783 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 332 – 364 | 33 | KACSP…SSFPL → DAMSEEDMLQAAVTMSLETV RNDLKTEGKK in isoform 2 and isoform 3. | VSP_002784 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 212 | 1 | V → M. Ref.1 Ref.2 Ref.4 Corresponds to variant rs1048755 [ dbSNP | Ensembl ]. | VAR_013688 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 306 | 1 | G → QQQQQQQQQQQQR. | VAR_013689 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 349 – 364 | 16 | Missing in allele MJD1a. | VAR_013690 | ||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 14 | 1 | C → A: Loss of ubiquitinated protein retention. Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 236 | 1 | S → A: Inhibits substrate trapping. Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 256 | 1 | S → A: Inhibits substrate trapping. Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 335 | 1 | S → A: No effect on ubiquitination. Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 252 | 1 | A → T in AAB63352. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 252 | 1 | A → T in AAB63353. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 252 | 1 | A → T in AAB63354. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1 – 3 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 14 – 22 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 23 – 25 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 30 – 49 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 53 – 55 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 56 – 62 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 73 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 78 – 85 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 86 – 88 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 90 – 96 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 97 – 100 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 106 – 108 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 109 – 116 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 119 – 126 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 129 – 134 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 141 – 143 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 145 – 158 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 161 – 167 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 173 – 176 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 178 – 180 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 222 – 240 | 19 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 243 – 245 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 246 – 257 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "CAG expansions in a novel gene for Machado-Joseph disease at chromosome 14q32.1." Kawaguchi Y., Okamoto T., Taniwaki M., Aizawa M., Inoue M., Katayama S., Kawakami H., Nakamura S., Nishimura M., Akiguchi I., Kimura J., Narumiya S., Kakizuka A. Nat. Genet. 8:221-228(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS MET-212; GLY-306 DELINS GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-ARG AND 349-TYR--LEU-364 DEL, INVOLVEMENT IN SCA3. Tissue: Brain. |
| [2] | "Machado-Joseph disease gene products carrying different carboxyl termini." Goto J., Watanabe M., Ichikawa Y., Yee S.-B., Ihara N., Endo K., Igarashi S., Takiyama Y., Gaspar C., Maciel P., Tsuji S., Rouleau G.A., Kanazawa I. Neurosci. Res. 28:373-377(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANTS MET-212; GLY-306 DELINS GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-ARG AND 349-TYR--LEU-364 DEL. |
| [3] | "The genomic structure and expression of MJD, the Machado-Joseph disease gene." Ichikawa Y., Goto J., Hattori M., Toyoda A., Ishii K., Jeong S.-Y., Hashida H., Masuda N., Ogata K., Kasai F., Hirai M., Maciel P., Rouleau G.A., Sakaki Y., Kanazawa I. J. Hum. Genet. 46:413-422(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3), VARIANT 349-TYR--LEU-364 DEL. |
| [4] | NIEHS SNPs program Submitted (JUL-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT MET-212. |
| [5] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLY-306 DELINS GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-GLN-ARG. Tissue: Mammary gland. |
| [8] | "Ataxin-3 is transported into the nucleus and associates with the nuclear matrix." Tait D., Riccio M., Sittler A., Scherzinger E., Santi S., Ognibene A., Maraldi N.M., Lehrach H., Wanker E.E. Hum. Mol. Genet. 7:991-997(1998) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [9] | "Ataxin-3 is a histone-binding protein with two independent transcriptional corepressor activities." Li F., Macfarlan T., Pittman R.N., Chakravarti D. J. Biol. Chem. 277:45004-45012(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [10] | "Josephin domain-containing proteins from a variety of species are active de-ubiquitination enzymes." Tzvetkov N., Breuer P. Biol. Chem. 388:973-978(2007) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, FUNCTION. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [12] | "Structural modeling of ataxin-3 reveals distant homology to adaptins." Albrecht M., Hoffmann D., Evert B.O., Schmitt I., Wuellner U., Lengauer T. Proteins 50:355-370(2003) [PubMed] [Europe PMC] [Abstract] Cited for: 3D-STRUCTURE MODELING. |
| [13] | "The solution structure of the Josephin domain of ataxin-3: structural determinants for molecular recognition." Nicastro G., Menon R.P., Masino L., Knowles P.P., McDonald N.Q., Pastore A. Proc. Natl. Acad. Sci. U.S.A. 102:10493-10498(2005) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1-182. |
| [14] | "Deubiquitinating function of ataxin-3: insights from the solution structure of the Josephin domain." Mao Y., Senic-Matuglia F., Di Fiore P.P., Polo S., Hodsdon M.E., De Camilli P. Proc. Natl. Acad. Sci. U.S.A. 102:12700-12705(2005) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 1-185, FUNCTION, MUTAGENESIS OF CYS-14; SER-236; SER-256 AND SER-335. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | S75313 mRNA. Translation: AAB33571.1. U64820 mRNA. Translation: AAB63352.1. U64821 mRNA. Translation: AAB63353.1. U64822 mRNA. Translation: AAB63354.1. AB050194 mRNA. Translation: BAB18798.1. AB038653 Genomic DNA. Translation: BAB55645.1. AB038653 Genomic DNA. Translation: BAB55646.1. EU009923 Genomic DNA. Translation: ABS29269.1. AL049872 Genomic DNA. No translation available. CH471061 Genomic DNA. Translation: EAW81472.1. BC033711 mRNA. Translation: AAH33711.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00219863. IPI00219864. IPI00979068. | ||||||||||||||||||||||||||||||||||||
| PIR | S50830. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001121168.1. NM_001127696.1. NP_004984.2. NM_004993.5. NP_109376.1. NM_030660.4. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.532632. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P54252. | ||||||||||||||||||||||||||||||||||||
| SMR | P54252. Positions 1-185, 220-264. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| IntAct | P54252. 14 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-272839. | ||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||
| MEROPS | C86.001. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | P54252. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 290457685. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | P54252. | ||||||||||||||||||||||||||||||||||||
| PRIDE | P54252. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 4287. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000340660; ENSP00000339110; ENSG00000066427. ENST00000393287; ENSP00000376965; ENSG00000066427. ENST00000532032; ENSP00000437157; ENSG00000066427. | ||||||||||||||||||||||||||||||||||||
| GeneID | 4287. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:4287. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc001yac.4. human. uc001yad.4. human. uc021rzo.1. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 4287. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC14M092524. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:7106. ATXN3. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB021976. HPA024123. | ||||||||||||||||||||||||||||||||||||
| MIM | 109150. phenotype. 607047. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P54252. | ||||||||||||||||||||||||||||||||||||
| Orphanet | 276238. Machado-Joseph disease type 1. 276241. Machado-Joseph disease type 2. 276244. Machado-Joseph disease type 3. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA134971833. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | NOG327234. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG025648. | ||||||||||||||||||||||||||||||||||||
| KO | K11863. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | P54252. | ||||||||||||||||||||||||||||||||||||
| Bgee | P54252. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | P54252. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR006155. Josephin. IPR003903. Ubiquitin-int_motif. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF02099. Josephin. 1 hit. PF02809. UIM. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PRINTS | PR01233. JOSEPHIN. | ||||||||||||||||||||||||||||||||||||
| SMART | SM00726. UIM. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS50957. JOSEPHIN. 1 hit. PS50330. UIM. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P54252. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 4287. | ||||||||||||||||||||||||||||||||||||
| NextBio | 16875. | ||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | A7LFZ5. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | ATX3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P54252 Secondary accession number(s): A7LFZ5 Q9H3N0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
