Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM domain kinase 2

Gene

LIMK2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.2 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei360ATPPROSITE-ProRule annotation1
Active sitei451By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi337 – 345ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • protein serine/threonine kinase activity Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

  • phosphorylation Source: UniProtKB
  • spermatogenesis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:HS11960-MONOMER.
BRENDAi2.7.10.2. 2681.
ReactomeiR-HSA-3928662. EPHB-mediated forward signaling.
R-HSA-416572. Sema4D induced cell migration and growth-cone collapse.
R-HSA-5627117. RHO GTPases Activate ROCKs.
SIGNORiP53671.

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain kinase 2 (EC:2.7.11.1)
Short name:
LIMK-2
Gene namesi
Name:LIMK2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:6614. LIMK2.

Subcellular locationi

Isoform LIMK2a :
Isoform LIMK2b :
  • Cytoplasm
  • Nucleus

  • Note: Isoform LIMK2b occurs mainly in the cytoplasm and is scarcely translocated to the nucleus.

GO - Cellular componenti

  • cis-Golgi network Source: Ensembl
  • cytoplasm Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi505T → E: Increases kinase activity. 1 Publication1
Mutagenesisi505T → V: Abolishes cofilin phosphorylation and enhancement of stress fiber formation. 1 Publication1

Organism-specific databases

DisGeNETi3985.
OpenTargetsiENSG00000182541.
PharmGKBiPA30387.

Chemistry databases

ChEMBLiCHEMBL5932.
GuidetoPHARMACOLOGYi2055.

Polymorphism and mutation databases

BioMutaiLIMK2.
DMDMi1708824.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000758091 – 638LIM domain kinase 2Add BLAST638

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei210PhosphothreonineCombined sources1
Modified residuei293PhosphoserineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei505Phosphothreonine; by ROCK1 and CDC42BP2 Publications1

Post-translational modificationi

Phosphorylated on serine and/or threonine residues by ROCK1.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP53671.
MaxQBiP53671.
PaxDbiP53671.
PeptideAtlasiP53671.
PRIDEiP53671.

PTM databases

iPTMnetiP53671.
PhosphoSitePlusiP53671.

Expressioni

Tissue specificityi

Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed.1 Publication

Gene expression databases

BgeeiENSG00000182541.
CleanExiHS_LIMK2.
ExpressionAtlasiP53671. baseline and differential.
GenevisibleiP53671. HS.

Organism-specific databases

HPAiCAB019313.
HPA008183.
HPA053882.

Interactioni

Subunit structurei

Binds ROCK1 and LKAP. Interacts with PARD3. Interacts with NISCH (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
HSP90AB1P082382EBI-1384350,EBI-352572

Protein-protein interaction databases

BioGridi110173. 35 interactors.
IntActiP53671. 25 interactors.
MINTiMINT-1190610.
STRINGi9606.ENSP00000339916.

Chemistry databases

BindingDBiP53671.

Structurei

Secondary structure

1638
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni73 – 75Combined sources3
Turni99 – 101Combined sources3
Beta strandi111 – 113Combined sources3
Beta strandi115 – 117Combined sources3
Beta strandi119 – 121Combined sources3
Helixi122 – 129Combined sources8
Beta strandi331 – 338Combined sources8
Beta strandi340 – 342Combined sources3
Beta strandi344 – 350Combined sources7
Turni351 – 353Combined sources3
Beta strandi356 – 361Combined sources6
Helixi367 – 375Combined sources9
Helixi377 – 382Combined sources6
Beta strandi391 – 396Combined sources6
Beta strandi398 – 406Combined sources9
Beta strandi410 – 412Combined sources3
Helixi413 – 417Combined sources5
Helixi425 – 444Combined sources20
Turni454 – 456Combined sources3
Beta strandi457 – 460Combined sources4
Beta strandi465 – 467Combined sources3
Turni510 – 512Combined sources3
Helixi515 – 518Combined sources4
Helixi527 – 541Combined sources15
Turni547 – 549Combined sources3
Helixi560 – 567Combined sources8
Helixi576 – 583Combined sources8
Helixi588 – 590Combined sources3
Helixi594 – 608Combined sources15
Beta strandi609 – 611Combined sources3
Helixi617 – 630Combined sources14

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X6ANMR-A62-129[»]
4TPTX-ray2.60A/B330-632[»]
ProteinModelPortaliP53671.
SMRiP53671.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP53671.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini12 – 63LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST52
Domaini72 – 124LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST53
Domaini152 – 239PDZPROSITE-ProRule annotationAdd BLAST88
Domaini331 – 608Protein kinasePROSITE-ProRule annotationAdd BLAST278

Sequence similaritiesi

Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiENOG410IEZ9. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00530000063025.
HOGENOMiHOG000013121.
HOVERGENiHBG052328.
InParanoidiP53671.
KOiK05744.
OMAiPECLPRT.
OrthoDBiEOG091G03ZL.
PhylomeDBiP53671.
TreeFamiTF318014.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
PF00595. PDZ. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS50106. PDZ. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform LIMK2a (identifier: P53671-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSALAGEDVW RCPGCGDHIA PSQIWYRTVN ETWHGSCFRC SECQDSLTNW
60 70 80 90 100
YYEKDGKLYC PKDYWGKFGE FCHGCSLLMT GPFMVAGEFK YHPECFACMS
110 120 130 140 150
CKVIIEDGDA YALVQHATLY CGKCHNEVVL APMFERLSTE SVQEQLPYSV
160 170 180 190 200
TLISMPATTE GRRGFSVSVE SACSNYATTV QVKEVNRMHI SPNNRNAIHP
210 220 230 240 250
GDRILEINGT PVRTLRVEEV EDAISQTSQT LQLLIEHDPV SQRLDQLRLE
260 270 280 290 300
ARLAPHMQNA GHPHALSTLD TKENLEGTLR RRSLRRSNSI SKSPGPSSPK
310 320 330 340 350
EPLLFSRDIS RSESLRCSSS YSQQIFRPCD LIHGEVLGKG FFGQAIKVTH
360 370 380 390 400
KATGKVMVMK ELIRCDEETQ KTFLTEVKVM RSLDHPNVLK FIGVLYKDKK
410 420 430 440 450
LNLLTEYIEG GTLKDFLRSM DPFPWQQKVR FAKGIASGMA YLHSMCIIHR
460 470 480 490 500
DLNSHNCLIK LDKTVVVADF GLSRLIVEER KRAPMEKATT KKRTLRKNDR
510 520 530 540 550
KKRYTVVGNP YWMAPEMLNG KSYDETVDIF SFGIVLCEII GQVYADPDCL
560 570 580 590 600
PRTLDFGLNV KLFWEKFVPT DCPPAFFPLA AICCRLEPES RPAFSKLEDS
610 620 630
FEALSLYLGE LGIPLPAELE ELDHTVSMQY GLTRDSPP
Length:638
Mass (Da):72,232
Last modified:October 1, 1996 - v1
Checksum:iFB51813D99AFAC18
GO
Isoform LIMK2b (identifier: P53671-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSC → MGSYLSVPAYFTSRDL

Show »
Length:617
Mass (Da):69,904
Checksum:i07449F035F01562C
GO
Isoform 3 (identifier: P53671-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSC → MGSYLSVPAYFTSRDL
     592-638: PAFSKLEDSF...QYGLTRDSPP → APPGAAGEGP...MQKLSTPQKK

Note: No experimental confirmation available.
Show »
Length:686
Mass (Da):77,886
Checksum:i5BEF0CE326A851B5
GO

Sequence cautioni

The sequence AAB54055 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03406935G → S.1 PublicationCorresponds to variant rs5997917dbSNPEnsembl.1
Natural variantiVAR_04224945D → N.1 PublicationCorresponds to variant rs35923988dbSNPEnsembl.1
Natural variantiVAR_042250213R → C.1 PublicationCorresponds to variant rs34930775dbSNPEnsembl.1
Natural variantiVAR_042251296P → R.1 PublicationCorresponds to variant rs34875793dbSNPEnsembl.1
Natural variantiVAR_050149381R → H.Corresponds to variant rs2229874dbSNPEnsembl.1
Natural variantiVAR_042252418R → C.1 PublicationCorresponds to variant rs35422808dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0122871 – 37MSALA…WHGSC → MGSYLSVPAYFTSRDL in isoform LIMK2b and isoform 3. 3 PublicationsAdd BLAST37
Alternative sequenceiVSP_043332592 – 638PAFSK…RDSPP → APPGAAGEGPGCADDEGPVR RQGKVTIKYDPKELRKHLNL EEWILEQLTRLYDCQEEEIS ELEIDVDELLDMESDDAWAS RVKELLVDCYKPTEAFISGL LDKIRAMQKLSTPQKK in isoform 3. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D45906 mRNA. Translation: BAA08312.1.
D85527 mRNA. Translation: BAA12827.1.
AL117466 mRNA. Translation: CAB55941.1.
CR456513 mRNA. Translation: CAG30399.1.
AK291640 mRNA. Translation: BAF84329.1.
AC002073 Genomic DNA. Translation: AAB54055.1. Sequence problems.
AC002073 Genomic DNA. Translation: AAB54056.1.
CH471095 Genomic DNA. Translation: EAW59954.1.
CH471095 Genomic DNA. Translation: EAW59956.1.
CH471095 Genomic DNA. Translation: EAW59958.1.
BC013051 mRNA. Translation: AAH13051.1.
CCDSiCCDS13891.1. [P53671-1]
CCDS13892.1. [P53671-2]
CCDS33637.1. [P53671-3]
PIRiA59196.
RefSeqiNP_001026971.1. NM_001031801.1. [P53671-3]
NP_005560.1. NM_005569.3. [P53671-1]
NP_057952.1. NM_016733.2. [P53671-2]
UniGeneiHs.474596.

Genome annotation databases

EnsembliENST00000331728; ENSP00000332687; ENSG00000182541. [P53671-1]
ENST00000333611; ENSP00000330470; ENSG00000182541. [P53671-2]
ENST00000340552; ENSP00000339916; ENSG00000182541. [P53671-3]
GeneIDi3985.
KEGGihsa:3985.
UCSCiuc003akh.4. human. [P53671-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D45906 mRNA. Translation: BAA08312.1.
D85527 mRNA. Translation: BAA12827.1.
AL117466 mRNA. Translation: CAB55941.1.
CR456513 mRNA. Translation: CAG30399.1.
AK291640 mRNA. Translation: BAF84329.1.
AC002073 Genomic DNA. Translation: AAB54055.1. Sequence problems.
AC002073 Genomic DNA. Translation: AAB54056.1.
CH471095 Genomic DNA. Translation: EAW59954.1.
CH471095 Genomic DNA. Translation: EAW59956.1.
CH471095 Genomic DNA. Translation: EAW59958.1.
BC013051 mRNA. Translation: AAH13051.1.
CCDSiCCDS13891.1. [P53671-1]
CCDS13892.1. [P53671-2]
CCDS33637.1. [P53671-3]
PIRiA59196.
RefSeqiNP_001026971.1. NM_001031801.1. [P53671-3]
NP_005560.1. NM_005569.3. [P53671-1]
NP_057952.1. NM_016733.2. [P53671-2]
UniGeneiHs.474596.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X6ANMR-A62-129[»]
4TPTX-ray2.60A/B330-632[»]
ProteinModelPortaliP53671.
SMRiP53671.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110173. 35 interactors.
IntActiP53671. 25 interactors.
MINTiMINT-1190610.
STRINGi9606.ENSP00000339916.

Chemistry databases

BindingDBiP53671.
ChEMBLiCHEMBL5932.
GuidetoPHARMACOLOGYi2055.

PTM databases

iPTMnetiP53671.
PhosphoSitePlusiP53671.

Polymorphism and mutation databases

BioMutaiLIMK2.
DMDMi1708824.

Proteomic databases

EPDiP53671.
MaxQBiP53671.
PaxDbiP53671.
PeptideAtlasiP53671.
PRIDEiP53671.

Protocols and materials databases

DNASUi3985.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331728; ENSP00000332687; ENSG00000182541. [P53671-1]
ENST00000333611; ENSP00000330470; ENSG00000182541. [P53671-2]
ENST00000340552; ENSP00000339916; ENSG00000182541. [P53671-3]
GeneIDi3985.
KEGGihsa:3985.
UCSCiuc003akh.4. human. [P53671-1]

Organism-specific databases

CTDi3985.
DisGeNETi3985.
GeneCardsiLIMK2.
HGNCiHGNC:6614. LIMK2.
HPAiCAB019313.
HPA008183.
HPA053882.
MIMi601988. gene.
neXtProtiNX_P53671.
OpenTargetsiENSG00000182541.
PharmGKBiPA30387.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEZ9. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00530000063025.
HOGENOMiHOG000013121.
HOVERGENiHBG052328.
InParanoidiP53671.
KOiK05744.
OMAiPECLPRT.
OrthoDBiEOG091G03ZL.
PhylomeDBiP53671.
TreeFamiTF318014.

Enzyme and pathway databases

BioCyciZFISH:HS11960-MONOMER.
BRENDAi2.7.10.2. 2681.
ReactomeiR-HSA-3928662. EPHB-mediated forward signaling.
R-HSA-416572. Sema4D induced cell migration and growth-cone collapse.
R-HSA-5627117. RHO GTPases Activate ROCKs.
SIGNORiP53671.

Miscellaneous databases

ChiTaRSiLIMK2. human.
EvolutionaryTraceiP53671.
GeneWikiiLIMK2.
GenomeRNAii3985.
PROiP53671.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000182541.
CleanExiHS_LIMK2.
ExpressionAtlasiP53671. baseline and differential.
GenevisibleiP53671. HS.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
PF00595. PDZ. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS50106. PDZ. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLIMK2_HUMAN
AccessioniPrimary (citable) accession number: P53671
Secondary accession number(s): A8K6H5
, Q7KZ80, Q7L3H5, Q96E10, Q99464, Q9UFU0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 2, 2016
This is version 175 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.