P53671 (LIMK2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 140.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LIM domain kinase 2 Short name=LIMK-2 EC=2.7.11.1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 638 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro. Ref.10 Ref.11 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subunit structure | Binds ROCK1 and LKAP. Interacts with PARD3. Interacts with NISCH By similarity. Ref.9 Ref.10 Ref.11 Ref.13 |
| Subcellular location | Isoform LIMK2a: Cytoplasm. Nucleus. Note: Isoform LIMK2a is distributed in the cytoplasm and the nucleus. Ref.2 Isoform LIMK2b: Cytoplasm. Nucleus. Note: Isoform LIMK2b occurs mainly in the cytoplasm and is scarcely translocated to the nucleus. Ref.2 |
| Tissue specificity | Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed. Ref.2 |
| Post-translational modification | Phosphorylated on serine and/or threonine residues by ROCK1. Ref.11 Ref.12 |
| Sequence similarities | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Contains 2 LIM zinc-binding domains. Contains 1 PDZ (DHR) domain. Contains 1 protein kinase domain. |
| Sequence caution | The sequence AAB54055.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | LIM domain Repeat |
| Ligand | ATP-binding Metal-binding Nucleotide-binding Zinc |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | spermatogenesis Inferred from electronic annotation. Source: Compara |
| Cellular_component | cis-Golgi network Inferred from electronic annotation. Source: Compara cytoplasmTraceable author statement Ref.1Ref.2. Source: UniProtKB nucleusTraceable author statement Ref.2. Source: UniProtKB |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW protein serine/threonine kinase activityTraceable author statement Ref.1. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HSP90AB1 | P08238 | 2 | EBI-1384350,EBI-352572 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform LIMK2a (identifier: P53671-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform LIMK2b (identifier: P53671-2) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSC → MGSYLSVPAYFTSRDL | ||||||
| Isoform 3 (identifier: P53671-3) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSC → MGSYLSVPAYFTSRDL 592-638: PAFSKLEDSF...QYGLTRDSPP → APPGAAGEGP...MQKLSTPQKK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||
Molecule processing | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 638 | 638 | LIM domain kinase 2 | PRO_0000075809 | ||||||||||||||||
Regions | ||||||||||||||||||||
| Domain | 12 – 63 | 52 | LIM zinc-binding 1 | |||||||||||||||||
| Domain | 72 – 124 | 53 | LIM zinc-binding 2 | |||||||||||||||||
| Domain | 152 – 239 | 88 | PDZ | |||||||||||||||||
| Domain | 331 – 608 | 278 | Protein kinase | |||||||||||||||||
| Nucleotide binding | 337 – 345 | 9 | ATP By similarity | |||||||||||||||||
Sites | ||||||||||||||||||||
| Active site | 451 | 1 | By similarity | |||||||||||||||||
| Binding site | 360 | 1 | ATP By similarity | |||||||||||||||||
Amino acid modifications | ||||||||||||||||||||
| Modified residue | 210 | 1 | Phosphothreonine Ref.14 | |||||||||||||||||
| Modified residue | 293 | 1 | Phosphoserine Ref.14 Ref.15 | |||||||||||||||||
| Modified residue | 298 | 1 | Phosphoserine Ref.15 | |||||||||||||||||
| Modified residue | 505 | 1 | Phosphothreonine; by ROCK1 and CDC42BP Ref.11 Ref.12 | |||||||||||||||||
Natural variations | ||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | MSALA…WHGSC → MGSYLSVPAYFTSRDL in isoform LIMK2b and isoform 3. | VSP_012287 | ||||||||||||||||
| Alternative sequence | 592 – 638 | 47 | PAFSK…RDSPP → APPGAAGEGPGCADDEGPVR RQGKVTIKYDPKELRKHLNL EEWILEQLTRLYDCQEEEIS ELEIDVDELLDMESDDAWAS RVKELLVDCYKPTEAFISGL LDKIRAMQKLSTPQKK in isoform 3. | VSP_043332 | ||||||||||||||||
| Natural variant | 35 | 1 | G → S. Ref.18 Corresponds to variant rs5997917 [ dbSNP | Ensembl ]. | VAR_034069 | ||||||||||||||||
| Natural variant | 45 | 1 | D → N. Ref.18 Corresponds to variant rs35923988 [ dbSNP | Ensembl ]. | VAR_042249 | ||||||||||||||||
| Natural variant | 213 | 1 | R → C. Ref.18 Corresponds to variant rs34930775 [ dbSNP | Ensembl ]. | VAR_042250 | ||||||||||||||||
| Natural variant | 296 | 1 | P → R. Ref.18 Corresponds to variant rs34875793 [ dbSNP | Ensembl ]. | VAR_042251 | ||||||||||||||||
| Natural variant | 381 | 1 | R → H. Corresponds to variant rs2229874 [ dbSNP | Ensembl ]. | VAR_050149 | ||||||||||||||||
| Natural variant | 418 | 1 | R → C. Ref.18 Corresponds to variant rs35422808 [ dbSNP | Ensembl ]. | VAR_042252 | ||||||||||||||||
Experimental info | ||||||||||||||||||||
| Mutagenesis | 505 | 1 | T → E: Increases kinase activity. Ref.11 | |||||||||||||||||
| Mutagenesis | 505 | 1 | T → V: Abolishes cofilin phosphorylation and enhancement of stress fiber formation. Ref.11 | |||||||||||||||||
Secondary structure | ||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||
| Turn | 73 – 75 | 3 | ||||||||||||||||||
| Turn | 99 – 101 | 3 | ||||||||||||||||||
| Beta strand | 111 – 113 | 3 | ||||||||||||||||||
| Beta strand | 115 – 117 | 3 | ||||||||||||||||||
| Beta strand | 119 – 121 | 3 | ||||||||||||||||||
| Helix | 122 – 129 | 8 | ||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of a novel family of serine/threonine kinases containing two N-terminal LIM motifs." Okano I., Hiraoka J., Otera H., Nunoue K., Ohashi K., Iwashita S., Hirai M., Mizuno K. J. Biol. Chem. 270:31321-31330(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LIMK2A). Tissue: Hepatoma. |
| [2] | "Subcellular localization and protein interaction of the human LIMK2 gene expressing alternative transcripts with tissue-specific regulation." Osada H., Hasada K., Inazawa J., Uchida K., Ueda R., Takahashi T., Takahashi T. Biochem. Biophys. Res. Commun. 229:582-589(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LIMK2A AND LIMK2B), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Lung. |
| [3] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LIMK2B). Tissue: Uterus. |
| [4] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:R84.1-R84.11(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LIMK2A). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LIMK2A). Tissue: Placenta. |
| [6] | "The DNA sequence of human chromosome 22." Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. Wright H.Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Ovary. |
| [9] | "Molecular cloning and characterization of novel large protein, limkain b1, which associates with the LIM-kinase 2." Miyamoto K., Nakamura T., Shirakawa K., Matsumoto K. Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases Cited for: INTERACTION WITH LKAP. |
| [10] | "Signaling from Rho to the actin cytoskeleton through protein kinases ROCK and LIM-kinase." Maekawa M., Ishizaki T., Boku S., Watanabe N., Fujita A., Iwamatsu A., Obinata T., Ohashi K., Mizuno K., Narumiya S. Science 285:895-898(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ROCK1. |
| [11] | "Specific activation of LIM kinase 2 via phosphorylation of threonine 505 by ROCK, a Rho-dependent protein kinase." Sumi T., Matsumoto K., Nakamura T. J. Biol. Chem. 276:670-676(2001) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-505, MUTAGENESIS OF THR-505, FUNCTION, INTERACTION WITH ROCK1. |
| [12] | "Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42-binding kinase alpha." Sumi T., Matsumoto K., Shibuya A., Nakamura T. J. Biol. Chem. 276:23092-23096(2001) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-505 BY CDC42BP. |
| [13] | "Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling." Wang Y., Du D., Fang L., Yang G., Zhang C., Zeng R., Ullrich A., Lottspeich F., Chen Z. EMBO J. 25:5058-5070(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PARD3. Tissue: Embryonic kidney. |
| [14] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-210 AND SER-293, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-293 AND SER-298, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [17] | "Solution structures of the second LIM domain of human LIM-kinase 2 (LIMK2)." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 62-129. |
| [18] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-35; ASN-45; CYS-213; ARG-296 AND CYS-418. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D45906 mRNA. Translation: BAA08312.1. D85527 mRNA. Translation: BAA12827.1. AL117466 mRNA. Translation: CAB55941.1. CR456513 mRNA. Translation: CAG30399.1. AK291640 mRNA. Translation: BAF84329.1. AC002073 Genomic DNA. Translation: AAB54055.1. Sequence problems. AC002073 Genomic DNA. Translation: AAB54056.1. CH471095 Genomic DNA. Translation: EAW59954.1. CH471095 Genomic DNA. Translation: EAW59956.1. CH471095 Genomic DNA. Translation: EAW59958.1. BC013051 mRNA. Translation: AAH13051.1. | ||||||||||||
| IPI | IPI00022872. IPI00025698. IPI00100853. | ||||||||||||
| PIR | A59196. | ||||||||||||
| RefSeq | NP_001026971.1. NM_001031801.1. NP_005560.1. NM_005569.3. NP_057952.1. NM_016733.2. | ||||||||||||
| UniGene | Hs.474596. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P53671. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P53671. 2 interactions. | ||||||||||||
| MINT | MINT-1190610. | ||||||||||||
| STRING | 9606.ENSP00000339916. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P53671. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 1708824. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P53671. | ||||||||||||
| PRIDE | P53671. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 3985. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000331728; ENSP00000332687; ENSG00000182541. ENST00000333611; ENSP00000330470; ENSG00000182541. ENST00000340552; ENSP00000339916; ENSG00000182541. | ||||||||||||
| GeneID | 3985. | ||||||||||||
| KEGG | hsa:3985. | ||||||||||||
| UCSC | uc003akh.3. human. uc003akk.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 3985. | ||||||||||||
| GeneCards | GC22P031608. | ||||||||||||
| HGNC | HGNC:6614. LIMK2. | ||||||||||||
| HPA | CAB019313. HPA008183. | ||||||||||||
| MIM | 601988. gene. | ||||||||||||
| neXtProt | NX_P53671. | ||||||||||||
| PharmGKB | PA30387. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0515. | ||||||||||||
| HOGENOM | HOG000013121. | ||||||||||||
| HOVERGEN | HBG052328. | ||||||||||||
| KO | K05744. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 2.7.10.2. 2681. | ||||||||||||
| Reactome | REACT_111045. Developmental Biology. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P53671. | ||||||||||||
| Bgee | P53671. | ||||||||||||
| CleanEx | HS_LIMK2. | ||||||||||||
| Genevestigator | P53671. | ||||||||||||
| GermOnline | ENSG00000182541. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.10.110.10. 2 hits. | ||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR001478. PDZ. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||
| Pfam | PF00412. LIM. 2 hits. PF00595. PDZ. 1 hit. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00132. LIM. 2 hits. SM00228. PDZ. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. SSF50156. PDZ. 1 hit. | ||||||||||||
| PROSITE | PS00478. LIM_DOMAIN_1. 2 hits. PS50023. LIM_DOMAIN_2. 2 hits. PS50106. PDZ. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P53671. | ||||||||||||
| ChEMBL | CHEMBL5932. | ||||||||||||
| ChiTaRS | LIMK2. human. | ||||||||||||
| EvolutionaryTrace | P53671. | ||||||||||||
| GenomeRNAi | 3985. | ||||||||||||
| NextBio | 15630. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | LIMK2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P53671 Secondary accession number(s): A8K6H5 Q9UFU0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
