Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P53671

- LIMK2_HUMAN

UniProt

P53671 - LIMK2_HUMAN

Protein

LIM domain kinase 2

Gene

LIMK2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 154 (01 Oct 2014)
      Sequence version 1 (01 Oct 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.2 Publications

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei360 – 3601ATPPROSITE-ProRule annotation
    Active sitei451 – 4511By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi337 – 3459ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. protein binding Source: IntAct
    3. protein serine/threonine kinase activity Source: UniProtKB
    4. zinc ion binding Source: InterPro

    GO - Biological processi

    1. phosphorylation Source: UniProtKB
    2. spermatogenesis Source: Ensembl

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Metal-binding, Nucleotide-binding, Zinc

    Enzyme and pathway databases

    BRENDAi2.7.10.2. 2681.
    ReactomeiREACT_19277. Sema4D induced cell migration and growth-cone collapse.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    LIM domain kinase 2 (EC:2.7.11.1)
    Short name:
    LIMK-2
    Gene namesi
    Name:LIMK2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 22

    Organism-specific databases

    HGNCiHGNC:6614. LIMK2.

    Subcellular locationi

    Isoform LIMK2a : Cytoplasm. Nucleus
    Note: Isoform LIMK2a is distributed in the cytoplasm and the nucleus.
    Isoform LIMK2b : Cytoplasm. Nucleus
    Note: Isoform LIMK2b occurs mainly in the cytoplasm and is scarcely translocated to the nucleus.

    GO - Cellular componenti

    1. cis-Golgi network Source: Ensembl
    2. cytoplasm Source: UniProtKB
    3. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi505 – 5051T → E: Increases kinase activity. 1 Publication
    Mutagenesisi505 – 5051T → V: Abolishes cofilin phosphorylation and enhancement of stress fiber formation. 1 Publication

    Organism-specific databases

    PharmGKBiPA30387.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 638638LIM domain kinase 2PRO_0000075809Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei210 – 2101Phosphothreonine1 Publication
    Modified residuei293 – 2931Phosphoserine2 Publications
    Modified residuei298 – 2981Phosphoserine1 Publication
    Modified residuei505 – 5051Phosphothreonine; by ROCK1 and CDC42BP2 Publications

    Post-translational modificationi

    Phosphorylated on serine and/or threonine residues by ROCK1.4 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiP53671.
    PaxDbiP53671.
    PRIDEiP53671.

    PTM databases

    PhosphoSiteiP53671.

    Expressioni

    Tissue specificityi

    Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed.1 Publication

    Gene expression databases

    ArrayExpressiP53671.
    BgeeiP53671.
    CleanExiHS_LIMK2.
    GenevestigatoriP53671.

    Organism-specific databases

    HPAiCAB019313.
    HPA008183.
    HPA053882.

    Interactioni

    Subunit structurei

    Binds ROCK1 and LKAP. Interacts with PARD3. Interacts with NISCH By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    HSP90AB1P082382EBI-1384350,EBI-352572

    Protein-protein interaction databases

    BioGridi110173. 10 interactions.
    IntActiP53671. 5 interactions.
    MINTiMINT-1190610.
    STRINGi9606.ENSP00000339916.

    Structurei

    Secondary structure

    1
    638
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni73 – 753
    Turni99 – 1013
    Beta strandi111 – 1133
    Beta strandi115 – 1173
    Beta strandi119 – 1213
    Helixi122 – 1298

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1X6ANMR-A62-129[»]
    ProteinModelPortaliP53671.
    SMRiP53671. Positions 12-132, 139-246, 276-623.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP53671.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini12 – 6352LIM zinc-binding 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini72 – 12453LIM zinc-binding 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini152 – 23988PDZPROSITE-ProRule annotationAdd
    BLAST
    Domaini331 – 608278Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Keywords - Domaini

    LIM domain, Repeat

    Phylogenomic databases

    eggNOGiCOG0515.
    HOGENOMiHOG000013121.
    HOVERGENiHBG052328.
    KOiK05744.
    OMAiDARLSPH.
    PhylomeDBiP53671.
    TreeFamiTF318014.

    Family and domain databases

    Gene3Di2.10.110.10. 2 hits.
    2.30.42.10. 1 hit.
    InterProiIPR011009. Kinase-like_dom.
    IPR001478. PDZ.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR001781. Znf_LIM.
    [Graphical view]
    PfamiPF00412. LIM. 2 hits.
    PF00595. PDZ. 1 hit.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view]
    SMARTiSM00132. LIM. 2 hits.
    SM00228. PDZ. 1 hit.
    [Graphical view]
    SUPFAMiSSF50156. SSF50156. 1 hit.
    SSF56112. SSF56112. 1 hit.
    PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 2 hits.
    PS50106. PDZ. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform LIMK2a (identifier: P53671-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSALAGEDVW RCPGCGDHIA PSQIWYRTVN ETWHGSCFRC SECQDSLTNW    50
    YYEKDGKLYC PKDYWGKFGE FCHGCSLLMT GPFMVAGEFK YHPECFACMS 100
    CKVIIEDGDA YALVQHATLY CGKCHNEVVL APMFERLSTE SVQEQLPYSV 150
    TLISMPATTE GRRGFSVSVE SACSNYATTV QVKEVNRMHI SPNNRNAIHP 200
    GDRILEINGT PVRTLRVEEV EDAISQTSQT LQLLIEHDPV SQRLDQLRLE 250
    ARLAPHMQNA GHPHALSTLD TKENLEGTLR RRSLRRSNSI SKSPGPSSPK 300
    EPLLFSRDIS RSESLRCSSS YSQQIFRPCD LIHGEVLGKG FFGQAIKVTH 350
    KATGKVMVMK ELIRCDEETQ KTFLTEVKVM RSLDHPNVLK FIGVLYKDKK 400
    LNLLTEYIEG GTLKDFLRSM DPFPWQQKVR FAKGIASGMA YLHSMCIIHR 450
    DLNSHNCLIK LDKTVVVADF GLSRLIVEER KRAPMEKATT KKRTLRKNDR 500
    KKRYTVVGNP YWMAPEMLNG KSYDETVDIF SFGIVLCEII GQVYADPDCL 550
    PRTLDFGLNV KLFWEKFVPT DCPPAFFPLA AICCRLEPES RPAFSKLEDS 600
    FEALSLYLGE LGIPLPAELE ELDHTVSMQY GLTRDSPP 638
    Length:638
    Mass (Da):72,232
    Last modified:October 1, 1996 - v1
    Checksum:iFB51813D99AFAC18
    GO
    Isoform LIMK2b (identifier: P53671-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-37: MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSC → MGSYLSVPAYFTSRDL

    Show »
    Length:617
    Mass (Da):69,904
    Checksum:i07449F035F01562C
    GO
    Isoform 3 (identifier: P53671-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-37: MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSC → MGSYLSVPAYFTSRDL
         592-638: PAFSKLEDSF...QYGLTRDSPP → APPGAAGEGP...MQKLSTPQKK

    Note: No experimental confirmation available.

    Show »
    Length:686
    Mass (Da):77,886
    Checksum:i5BEF0CE326A851B5
    GO

    Sequence cautioni

    The sequence AAB54055.1 differs from that shown. Reason: Erroneous gene model prediction.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti35 – 351G → S.1 Publication
    Corresponds to variant rs5997917 [ dbSNP | Ensembl ].
    VAR_034069
    Natural varianti45 – 451D → N.1 Publication
    Corresponds to variant rs35923988 [ dbSNP | Ensembl ].
    VAR_042249
    Natural varianti213 – 2131R → C.1 Publication
    Corresponds to variant rs34930775 [ dbSNP | Ensembl ].
    VAR_042250
    Natural varianti296 – 2961P → R.1 Publication
    Corresponds to variant rs34875793 [ dbSNP | Ensembl ].
    VAR_042251
    Natural varianti381 – 3811R → H.
    Corresponds to variant rs2229874 [ dbSNP | Ensembl ].
    VAR_050149
    Natural varianti418 – 4181R → C.1 Publication
    Corresponds to variant rs35422808 [ dbSNP | Ensembl ].
    VAR_042252

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3737MSALA…WHGSC → MGSYLSVPAYFTSRDL in isoform LIMK2b and isoform 3. 3 PublicationsVSP_012287Add
    BLAST
    Alternative sequencei592 – 63847PAFSK…RDSPP → APPGAAGEGPGCADDEGPVR RQGKVTIKYDPKELRKHLNL EEWILEQLTRLYDCQEEEIS ELEIDVDELLDMESDDAWAS RVKELLVDCYKPTEAFISGL LDKIRAMQKLSTPQKK in isoform 3. 1 PublicationVSP_043332Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D45906 mRNA. Translation: BAA08312.1.
    D85527 mRNA. Translation: BAA12827.1.
    AL117466 mRNA. Translation: CAB55941.1.
    CR456513 mRNA. Translation: CAG30399.1.
    AK291640 mRNA. Translation: BAF84329.1.
    AC002073 Genomic DNA. Translation: AAB54055.1. Sequence problems.
    AC002073 Genomic DNA. Translation: AAB54056.1.
    CH471095 Genomic DNA. Translation: EAW59954.1.
    CH471095 Genomic DNA. Translation: EAW59956.1.
    CH471095 Genomic DNA. Translation: EAW59958.1.
    BC013051 mRNA. Translation: AAH13051.1.
    CCDSiCCDS13891.1. [P53671-1]
    CCDS13892.1. [P53671-2]
    CCDS33637.1. [P53671-3]
    PIRiA59196.
    RefSeqiNP_001026971.1. NM_001031801.1. [P53671-3]
    NP_005560.1. NM_005569.3. [P53671-1]
    NP_057952.1. NM_016733.2. [P53671-2]
    UniGeneiHs.474596.

    Genome annotation databases

    EnsembliENST00000331728; ENSP00000332687; ENSG00000182541. [P53671-1]
    ENST00000333611; ENSP00000330470; ENSG00000182541. [P53671-2]
    ENST00000340552; ENSP00000339916; ENSG00000182541. [P53671-3]
    GeneIDi3985.
    KEGGihsa:3985.
    UCSCiuc003akh.3. human. [P53671-1]
    uc003akj.3. human. [P53671-3]
    uc003akk.3. human. [P53671-2]

    Polymorphism databases

    DMDMi1708824.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D45906 mRNA. Translation: BAA08312.1 .
    D85527 mRNA. Translation: BAA12827.1 .
    AL117466 mRNA. Translation: CAB55941.1 .
    CR456513 mRNA. Translation: CAG30399.1 .
    AK291640 mRNA. Translation: BAF84329.1 .
    AC002073 Genomic DNA. Translation: AAB54055.1 . Sequence problems.
    AC002073 Genomic DNA. Translation: AAB54056.1 .
    CH471095 Genomic DNA. Translation: EAW59954.1 .
    CH471095 Genomic DNA. Translation: EAW59956.1 .
    CH471095 Genomic DNA. Translation: EAW59958.1 .
    BC013051 mRNA. Translation: AAH13051.1 .
    CCDSi CCDS13891.1. [P53671-1 ]
    CCDS13892.1. [P53671-2 ]
    CCDS33637.1. [P53671-3 ]
    PIRi A59196.
    RefSeqi NP_001026971.1. NM_001031801.1. [P53671-3 ]
    NP_005560.1. NM_005569.3. [P53671-1 ]
    NP_057952.1. NM_016733.2. [P53671-2 ]
    UniGenei Hs.474596.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1X6A NMR - A 62-129 [» ]
    ProteinModelPortali P53671.
    SMRi P53671. Positions 12-132, 139-246, 276-623.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110173. 10 interactions.
    IntActi P53671. 5 interactions.
    MINTi MINT-1190610.
    STRINGi 9606.ENSP00000339916.

    Chemistry

    BindingDBi P53671.
    ChEMBLi CHEMBL5932.
    GuidetoPHARMACOLOGYi 2055.

    PTM databases

    PhosphoSitei P53671.

    Polymorphism databases

    DMDMi 1708824.

    Proteomic databases

    MaxQBi P53671.
    PaxDbi P53671.
    PRIDEi P53671.

    Protocols and materials databases

    DNASUi 3985.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000331728 ; ENSP00000332687 ; ENSG00000182541 . [P53671-1 ]
    ENST00000333611 ; ENSP00000330470 ; ENSG00000182541 . [P53671-2 ]
    ENST00000340552 ; ENSP00000339916 ; ENSG00000182541 . [P53671-3 ]
    GeneIDi 3985.
    KEGGi hsa:3985.
    UCSCi uc003akh.3. human. [P53671-1 ]
    uc003akj.3. human. [P53671-3 ]
    uc003akk.3. human. [P53671-2 ]

    Organism-specific databases

    CTDi 3985.
    GeneCardsi GC22P031608.
    HGNCi HGNC:6614. LIMK2.
    HPAi CAB019313.
    HPA008183.
    HPA053882.
    MIMi 601988. gene.
    neXtProti NX_P53671.
    PharmGKBi PA30387.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOGENOMi HOG000013121.
    HOVERGENi HBG052328.
    KOi K05744.
    OMAi DARLSPH.
    PhylomeDBi P53671.
    TreeFami TF318014.

    Enzyme and pathway databases

    BRENDAi 2.7.10.2. 2681.
    Reactomei REACT_19277. Sema4D induced cell migration and growth-cone collapse.

    Miscellaneous databases

    ChiTaRSi LIMK2. human.
    EvolutionaryTracei P53671.
    GeneWikii LIMK2.
    GenomeRNAii 3985.
    NextBioi 15630.
    PROi P53671.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P53671.
    Bgeei P53671.
    CleanExi HS_LIMK2.
    Genevestigatori P53671.

    Family and domain databases

    Gene3Di 2.10.110.10. 2 hits.
    2.30.42.10. 1 hit.
    InterProi IPR011009. Kinase-like_dom.
    IPR001478. PDZ.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR001781. Znf_LIM.
    [Graphical view ]
    Pfami PF00412. LIM. 2 hits.
    PF00595. PDZ. 1 hit.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view ]
    SMARTi SM00132. LIM. 2 hits.
    SM00228. PDZ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50156. SSF50156. 1 hit.
    SSF56112. SSF56112. 1 hit.
    PROSITEi PS00478. LIM_DOMAIN_1. 2 hits.
    PS50023. LIM_DOMAIN_2. 2 hits.
    PS50106. PDZ. 1 hit.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of a novel family of serine/threonine kinases containing two N-terminal LIM motifs."
      Okano I., Hiraoka J., Otera H., Nunoue K., Ohashi K., Iwashita S., Hirai M., Mizuno K.
      J. Biol. Chem. 270:31321-31330(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LIMK2A).
      Tissue: Hepatoma.
    2. "Subcellular localization and protein interaction of the human LIMK2 gene expressing alternative transcripts with tissue-specific regulation."
      Osada H., Hasada K., Inazawa J., Uchida K., Ueda R., Takahashi T., Takahashi T.
      Biochem. Biophys. Res. Commun. 229:582-589(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LIMK2A AND LIMK2B), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Lung.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LIMK2B).
      Tissue: Uterus.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LIMK2A).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LIMK2A).
      Tissue: Placenta.
    6. "The DNA sequence of human chromosome 22."
      Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
      , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
      Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Ovary.
    9. "Molecular cloning and characterization of novel large protein, limkain b1, which associates with the LIM-kinase 2."
      Miyamoto K., Nakamura T., Shirakawa K., Matsumoto K.
      Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: INTERACTION WITH LKAP.
    10. "Signaling from Rho to the actin cytoskeleton through protein kinases ROCK and LIM-kinase."
      Maekawa M., Ishizaki T., Boku S., Watanabe N., Fujita A., Iwamatsu A., Obinata T., Ohashi K., Mizuno K., Narumiya S.
      Science 285:895-898(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH ROCK1.
    11. "Specific activation of LIM kinase 2 via phosphorylation of threonine 505 by ROCK, a Rho-dependent protein kinase."
      Sumi T., Matsumoto K., Nakamura T.
      J. Biol. Chem. 276:670-676(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT THR-505, MUTAGENESIS OF THR-505, FUNCTION, INTERACTION WITH ROCK1.
    12. "Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42-binding kinase alpha."
      Sumi T., Matsumoto K., Shibuya A., Nakamura T.
      J. Biol. Chem. 276:23092-23096(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT THR-505 BY CDC42BP.
    13. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-210 AND SER-293, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-293 AND SER-298, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. "Solution structures of the second LIM domain of human LIM-kinase 2 (LIMK2)."
      RIKEN structural genomics initiative (RSGI)
      Submitted (NOV-2005) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 62-129.
    17. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-35; ASN-45; CYS-213; ARG-296 AND CYS-418.

    Entry informationi

    Entry nameiLIMK2_HUMAN
    AccessioniPrimary (citable) accession number: P53671
    Secondary accession number(s): A8K6H5
    , Q7KZ80, Q7L3H5, Q96E10, Q99464, Q9UFU0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: October 1, 1996
    Last modified: October 1, 2014
    This is version 154 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 22
      Human chromosome 22: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3