Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM domain kinase 2

Gene

Limk2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.By similarity

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei360 – 3601ATPPROSITE-ProRule annotation
Active sitei451 – 4511By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi337 – 3459ATPPROSITE-ProRule annotation

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • protein serine/threonine kinase activity Source: RGD
  • zinc ion binding Source: InterPro

GO - Biological processi

  • protein phosphorylation Source: RGD
  • spermatid development Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

BRENDAi2.7.10.2. 5301.

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain kinase 2 (EC:2.7.11.1)
Short name:
LIMK-2
Gene namesi
Name:Limk2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 14

Organism-specific databases

RGDi62056. Limk2.

Subcellular locationi

GO - Cellular componenti

  • cis-Golgi network Source: Ensembl
  • cytosol Source: Reactome
  • nucleus Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 638638LIM domain kinase 2PRO_0000075811Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei210 – 2101PhosphothreonineBy similarity
Modified residuei293 – 2931PhosphoserineBy similarity
Modified residuei298 – 2981PhosphoserineBy similarity
Modified residuei505 – 5051Phosphothreonine; by ROCK1 and CDC42BPBy similarity

Post-translational modificationi

Phosphorylated on serine and/or threonine residues by ROCK1.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP53670.
PRIDEiP53670.

PTM databases

iPTMnetiP53670.
PhosphoSiteiP53670.

Expressioni

Tissue specificityi

Found in various tissues at moderate levels, except for testis, which shows very low expression.

Gene expression databases

ExpressionAtlasiP53670. baseline and differential.
GenevisibleiP53670. RN.

Interactioni

Subunit structurei

Binds ROCK1 and LKAP. Interacts with NISCH and PARD3 (By similarity).By similarity

Protein-protein interaction databases

IntActiP53670. 1 interaction.
STRINGi10116.ENSRNOP00000026032.

Structurei

3D structure databases

ProteinModelPortaliP53670.
SMRiP53670. Positions 62-132, 139-246.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini12 – 6352LIM zinc-binding 1PROSITE-ProRule annotationAdd
BLAST
Domaini72 – 12453LIM zinc-binding 2PROSITE-ProRule annotationAdd
BLAST
Domaini152 – 23988PDZPROSITE-ProRule annotationAdd
BLAST
Domaini331 – 608278Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 LIM zinc-binding domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiENOG410IEZ9. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00530000063025.
HOGENOMiHOG000013121.
HOVERGENiHBG052328.
InParanoidiP53670.
KOiK05744.
OMAiPECLPRT.
OrthoDBiEOG73V6JQ.
PhylomeDBiP53670.
TreeFamiTF318014.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
PF00595. PDZ. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS50106. PDZ. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform LIMK2A (identifier: P53670-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAALAGEEAW RCRGCGNYVP LSQRLYRTAN EAWHSSCFRC SECQESLTNW
60 70 80 90 100
YYEKDGKLYC HKDYWAKFGE FCHGCSLLMT GPAMVAGEFK YHPECFACMS
110 120 130 140 150
CKVIIEDGDA YALVQHATLY CGKCHNEVVL APMFERLSTE SVQDQLPYSV
160 170 180 190 200
TLISMPATTE CRRGFSVSVE SASSNYATTV QVKEVNRMHI SPNNRNAIHP
210 220 230 240 250
GDRILEINGT PVRTLRVEEV EDAINQTSQT LQLLIEHDPV PQRLDQLRLD
260 270 280 290 300
TRLSPHMQSS GHTLMLSTLD AKENQEGTLR RRSLRRSNSI SKSPGPSSPK
310 320 330 340 350
EPLLLSRDIS RSESLRCSSS YSQQIFRPCD LIHGEVLGKG FFGQAIKVTH
360 370 380 390 400
KATGKVMVMK ELIRCDEETQ KTFLTEVKVM RSLDHPNVLK FIGVLYKDKK
410 420 430 440 450
LNLLTEYIEG GTLKDFLRNV DPFPWQQKVR FAKGIASGMA YLHSMCIIHR
460 470 480 490 500
DLNSHNCLIK LDKTVVVADF GLSRLIVEER KRPPVEKAAT KKRTLRKSDR
510 520 530 540 550
KKRYTVVGNP YWMAPEMLNG KSYDETVDVF SFGIVLCEII GQVYADPDCL
560 570 580 590 600
PRTLDFGLNV KLFWEKFVPT DCPPAFFPLA AICCKLEPES RPAFSKLEDS
610 620 630
FEALSLFLGE LAIPLPAELE ELDHTVSMEY GLTRDSPP
Length:638
Mass (Da):72,202
Last modified:October 1, 1996 - v1
Checksum:iA7E2D525751BE4F3
GO
Isoform LIMK2B (identifier: P53670-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MAALAGEEAWRCRGCGNYVPLSQRLYRTANEAWHSSC → MGSYLSVPAYFTSRDP

Show »
Length:617
Mass (Da):69,834
Checksum:iFE981C7C8A54B845
GO
Isoform LIMK2C (identifier: P53670-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MAALAGEEAWRCRGCGNYVPLSQRLYRTANEAWHSSC → MGSYLSVPAYFTSRDP
     348-371: VTHKATGKVMVMKELIRCDEETQK → SWEGGSGDSQSHRQSDGHEGVNSL
     372-638: Missing.

Show »
Length:350
Mass (Da):39,184
Checksum:i31EB7E8D2FC48A60
GO
Isoform LIMK2D (identifier: P53670-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MAALAGEEAWRCRGCGNYVPLSQRLYRTANEAWHSSC → MGSYLSVPAYFTSRDP
     185-638: Missing.

Show »
Length:163
Mass (Da):18,353
Checksum:i51460FE0D2C5D615
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3737MAALA…WHSSC → MGSYLSVPAYFTSRDP in isoform LIMK2B, isoform LIMK2C and isoform LIMK2D. 1 PublicationVSP_003128Add
BLAST
Alternative sequencei185 – 638454Missing in isoform LIMK2D. 1 PublicationVSP_003131Add
BLAST
Alternative sequencei348 – 37124VTHKA…EETQK → SWEGGSGDSQSHRQSDGHEG VNSL in isoform LIMK2C. 1 PublicationVSP_003129Add
BLAST
Alternative sequencei372 – 638267Missing in isoform LIMK2C. 1 PublicationVSP_003130Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D31874 mRNA. Translation: BAA06673.1.
D31875 mRNA. Translation: BAA06674.1.
D31876 mRNA. Translation: BAA06675.1.
D31877 mRNA. Translation: BAA06676.1.
PIRiI78846.
I78847.
I78848.
RefSeqiNP_077049.2. NM_024135.2. [P53670-1]
XP_006251298.1. XM_006251236.2. [P53670-2]
UniGeneiRn.11013.

Genome annotation databases

EnsembliENSRNOT00000026032; ENSRNOP00000026032; ENSRNOG00000019000. [P53670-1]
ENSRNOT00000050005; ENSRNOP00000044951; ENSRNOG00000019000. [P53670-2]
ENSRNOT00000057673; ENSRNOP00000054482; ENSRNOG00000019000. [P53670-4]
GeneIDi29524.
KEGGirno:29524.
UCSCiRGD:62056. rat. [P53670-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D31874 mRNA. Translation: BAA06673.1.
D31875 mRNA. Translation: BAA06674.1.
D31876 mRNA. Translation: BAA06675.1.
D31877 mRNA. Translation: BAA06676.1.
PIRiI78846.
I78847.
I78848.
RefSeqiNP_077049.2. NM_024135.2. [P53670-1]
XP_006251298.1. XM_006251236.2. [P53670-2]
UniGeneiRn.11013.

3D structure databases

ProteinModelPortaliP53670.
SMRiP53670. Positions 62-132, 139-246.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP53670. 1 interaction.
STRINGi10116.ENSRNOP00000026032.

PTM databases

iPTMnetiP53670.
PhosphoSiteiP53670.

Proteomic databases

PaxDbiP53670.
PRIDEiP53670.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000026032; ENSRNOP00000026032; ENSRNOG00000019000. [P53670-1]
ENSRNOT00000050005; ENSRNOP00000044951; ENSRNOG00000019000. [P53670-2]
ENSRNOT00000057673; ENSRNOP00000054482; ENSRNOG00000019000. [P53670-4]
GeneIDi29524.
KEGGirno:29524.
UCSCiRGD:62056. rat. [P53670-1]

Organism-specific databases

CTDi3985.
RGDi62056. Limk2.

Phylogenomic databases

eggNOGiENOG410IEZ9. Eukaryota.
COG0515. LUCA.
GeneTreeiENSGT00530000063025.
HOGENOMiHOG000013121.
HOVERGENiHBG052328.
InParanoidiP53670.
KOiK05744.
OMAiPECLPRT.
OrthoDBiEOG73V6JQ.
PhylomeDBiP53670.
TreeFamiTF318014.

Enzyme and pathway databases

BRENDAi2.7.10.2. 5301.

Miscellaneous databases

PROiP53670.

Gene expression databases

ExpressionAtlasiP53670. baseline and differential.
GenevisibleiP53670. RN.

Family and domain databases

Gene3Di2.10.110.10. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR011009. Kinase-like_dom.
IPR001478. PDZ.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 2 hits.
PF00595. PDZ. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 2 hits.
PS50106. PDZ. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "LIMK-1 and LIMK-2, two members of a LIM motif-containing protein kinase family."
    Nunoue K., Ohashi K., Okano I., Mizuno K.
    Oncogene 11:701-710(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LIMK2A; LIMK2B; LIMK2C AND LIMK2D).
    Strain: Wistar.
    Tissue: Brain.

Entry informationi

Entry nameiLIMK2_RAT
AccessioniPrimary (citable) accession number: P53670
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: June 8, 2016
This is version 135 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.