P53667 (LIMK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 144.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LIM domain kinase 1 Short name=LIMK-1 EC=2.7.11.1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 647 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways. Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop. LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin-2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton. In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation. Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly. Stimulates axonal outgrowth and may be involved in brain development. Isoform 3 has a dominant negative effect on actin cytoskeletal changes. Ref.4 Ref.9 Ref.13 Ref.14 Ref.17 Ref.18 Ref.21 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Subunit structure | Interacts (via LIM domain) with the cytoplasmic domain of NRG1 By similarity. Interacts with NISCH By similarity. Interacts with RLIM and RNF6 By similarity. Self-associates to form homodimers. Interacts with HSP90AA1; this interaction promotes LIMK1 dimerization and subsequent transphosphorylation. Interacts with CDN1C. Interacts with SSH1. Interacts with ROCK1. Ref.9 Ref.10 Ref.15 Ref.17 Ref.20 |
| Subcellular location | Cytoplasm. Nucleus. Note: Predominantly found in the cytoplasm. Ref.4 Ref.18 Ref.27 |
| Tissue specificity | Highest expression in both adult and fetal nervous system. Detected ubiquitously throughout the different regions of adult brain, with highest levels in the cerebral cortex. Expressed to a lesser extent in heart and skeletal muscle. |
| Post-translational modification | Autophosphorylated By similarity. Phosphorylated on Thr-508 by ROCK1 and PAK1, resulting in activation. Phosphorylated by PAK4 which increases the ability of LIMK1 to phosphorylate cofilin. Phosphorylated at Ser-323 by MAPKAPK2 during activation of VEGFA-induced signaling, which results in activation of LIMK1 and promotion of actin reorganization, cell migration, and tubule formation of endothelial cells. Dephosphorylated and inactivated by SSH1. Phosphorylated by CDC42BP. Ref.8 Ref.10 Ref.11 Ref.12 Ref.17 Ref.19 Ubiquitinated. 'Lys-48'-linked polyubiquitination by RNF6 leads to proteasomal degradation through the 26S proteasome, modulating LIMK1 levels in the growth cone and its effect on axonal outgrowth. Also polyubiquitinated by RLIM By similarity. |
| Involvement in disease | LIMK1 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. |
| Sequence similarities | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Contains 2 LIM zinc-binding domains. Contains 1 PDZ (DHR) domain. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Arrb1 | P29066 | 2 | EBI-444403,EBI-4303019 | From a different organism. |
| Arrb2 | P29067 | 2 | EBI-444403,EBI-1636616 | From a different organism. |
| LATS1 | O95835 | 5 | EBI-444403,EBI-444209 | |
| MMP14 | P50281 | 4 | EBI-444403,EBI-992788 | |
| PAK1 | Q13153 | 5 | EBI-444403,EBI-1307 | |
| PAK2 | Q13177 | 2 | EBI-444403,EBI-1045887 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P53667-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P53667-2) The sequence of this isoform differs from the canonical sequence as follows: 1-14: Missing. | ||||||
| Isoform 3 (identifier: P53667-3) The sequence of this isoform differs from the canonical sequence as follows: 294-305: LRSCSIDRSPGA → FARTWVALSPSA 306-647: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: P53667-4) The sequence of this isoform differs from the canonical sequence as follows: 1-51: MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFR → MLLASAPRRRRFLQRAK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 647 | 647 | LIM domain kinase 1 | PRO_0000075803 | |||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 25 – 75 | 51 | LIM zinc-binding 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 84 – 137 | 54 | LIM zinc-binding 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 165 – 258 | 94 | PDZ | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 339 – 604 | 266 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 345 – 353 | 9 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 460 | 1 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 368 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 210 | 1 | Phosphoserine Ref.23 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 229 | 1 | Phosphothreonine Ref.23 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 302 | 1 | Phosphoserine Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 307 | 1 | Phosphoserine Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 310 | 1 | Phosphoserine Ref.23 Ref.24 Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 323 | 1 | Phosphoserine; by MAPKAPK2 Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 337 | 1 | Phosphoserine Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 508 | 1 | Phosphothreonine; by ROCK1 and PAK1 Ref.8 Ref.10 Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 51 | 51 | MRLTL…ADCFR → MLLASAPRRRRFLQRAK in isoform 4. | VSP_043331 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 14 | 14 | Missing in isoform 2. | VSP_003125 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 294 – 305 | 12 | LRSCS…RSPGA → FARTWVALSPSA in isoform 3. | VSP_003126 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 306 – 647 | 342 | Missing in isoform 3. | VSP_003127 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 190 | 1 | G → A. Ref.28 Corresponds to variant rs35827364 [ dbSNP | Ensembl ]. | VAR_042246 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 247 | 1 | S → N. Ref.28 Corresponds to variant rs55661242 [ dbSNP | Ensembl ]. | VAR_042247 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 422 | 1 | R → Q. Ref.28 Corresponds to variant rs55679316 [ dbSNP | Ensembl ]. | VAR_042248 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 580 | 1 | F → Y. Ref.2 Ref.3 Corresponds to variant rs178412 [ dbSNP | Ensembl ]. | VAR_050148 | |||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 84 | 1 | C → S: Enhances actin aggregation. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 177 – 178 | 2 | GL → EA: Enhances actin aggregation. | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 460 | 1 | D → N: Abrogates kinase activity. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 496 – 506 | 11 | Missing: Reduces actin aggregation. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 503 – 505 | 3 | RKK → GAA: Abolishes kinase activity. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 508 | 1 | T → A: Abolishes activation by ROCK1. Ref.4 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 508 | 1 | T → EE: Enhances kinase activity. Ref.4 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 508 | 1 | T → V or E: Reduces kinase activity. Ref.4 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 332 – 334 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 336 – 338 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 339 – 346 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 349 – 358 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 359 – 361 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 364 – 371 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 375 – 388 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 399 – 405 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 408 – 414 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 421 – 427 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 434 – 453 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 465 – 468 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 474 – 476 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 513 – 515 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 518 – 521 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 529 – 544 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 550 – 552 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 559 – 561 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 563 – 569 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 579 – 586 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 591 – 593 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 597 – 613 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 618 – 634 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a human cDNA encoding a novel protein kinase with two repeats of the LIM/double zinc finger motif." Mizuno K., Okano I., Ohashi K., Nunoue K., Kuma K., Miyata T., Nakamura T. Oncogene 9:1605-1612(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "LIM-kinase1 hemizygosity implicated in impaired visuospatial constructive cognition." Frangiskakis J.M., Ewart A.K., Morris C.A., Mervis C.B., Bertrand J., Robinson B.F., Klein B.P., Ensing G.J., Everett L.A., Green E.D., Proeschel C., Gutowski N.J., Noble M., Atkinson D.L., Odelberg S.J., Keating M.T. Cell 86:59-69(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2), VARIANT TYR-580. Tissue: Hippocampus and Placenta. |
| [3] | "Identification of genes from a 500-kb region at 7q11.23 that is commonly deleted in Williams syndrome patients." Osborne L.R., Martindale D.W., Scherer S.W., Shi X.-M., Huizenga J., Heng H.H.Q., Costa T., Pober B., Lew L., Brinkman J., Rommens J., Koop B.F., Tsui L.-C. Genomics 36:328-336(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT TYR-580, GENE DELETION IN WILLIAMS-BEUREN SYNDROME. |
| [4] | "Structural features of LIM kinase that control effects on the actin cytoskeleton." Edwards D.C., Gill G.N. J. Biol. Chem. 274:11352-11361(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SELF-ASSOCIATION, SUBCELLULAR LOCATION, MUTAGENESIS OF CYS-84; 177-GLY-LEU-178; ASP-460; 496-ARG--ARG-506; 503-ARG--GLY-505 AND THR-508. Tissue: Epidermal carcinoma. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Placenta. |
| [6] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "Activation of LIM-kinase by Pak1 couples Rac/Cdc42 GTPase signalling to actin cytoskeletal dynamics." Edwards D.C., Sanders L.C., Bokoch G.M., Gill G.N. Nat. Cell Biol. 1:253-259(1999) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-508 BY PAK1. |
| [9] | "Signaling from Rho to the actin cytoskeleton through protein kinases ROCK and LIM-kinase." Maekawa M., Ishizaki T., Boku S., Watanabe N., Fujita A., Iwamatsu A., Obinata T., Ohashi K., Mizuno K., Narumiya S. Science 285:895-898(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ROCK1. |
| [10] | "Rho-associated kinase ROCK activates LIM-kinase 1 by phosphorylation at threonine 508 within the activation loop." Ohashi K., Nagata K., Maekawa M., Ishizaki T., Narumiya S., Mizuno K. J. Biol. Chem. 275:3577-3582(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-508, MUTAGENESIS OF THR-508, INTERACTION WITH ROCK1. |
| [11] | "Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42-binding kinase alpha." Sumi T., Matsumoto K., Shibuya A., Nakamura T. J. Biol. Chem. 276:23092-23096(2001) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION BY CDC42BP. |
| [12] | "Cytoskeletal changes regulated by the PAK4 serine/threonine kinase are mediated by LIM kinase 1 and cofilin." Dan C., Kelly A., Bernard O., Minden A. J. Biol. Chem. 276:32115-32121(2001) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION BY PAK4. |
| [13] | "Control of actin reorganization by Slingshot, a family of phosphatases that dephosphorylate ADF/cofilin." Niwa R., Nagata-Ohashi K., Takeichi M., Mizuno K., Uemura T. Cell 108:233-246(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [14] | "Cell cycle-associated changes in Slingshot phosphatase activity and roles in cytokinesis in animal cells." Kaji N., Ohashi K., Shuin M., Niwa R., Uemura T., Mizuno K. J. Biol. Chem. 278:33450-33455(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [15] | "p57Kip2 regulates actin dynamics by binding and translocating LIM-kinase 1 to the nucleus." Yokoo T., Toyoshima H., Miura M., Wang Y., Iida K.T., Suzuki H., Sone H., Shimano H., Gotoda T., Nishimori S., Tanaka K., Yamada N. J. Biol. Chem. 278:52919-52923(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CDKN1C. |
| [16] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [17] | "Interplay between components of a novel LIM kinase-slingshot phosphatase complex regulates cofilin." Soosairajah J., Maiti S., Wiggan O., Sarmiere P., Moussi N., Sarcevic B., Sampath R., Bamburg J.R., Bernard O. EMBO J. 24:473-486(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH SSH1, PHOSPHORYLATION AT THR-508, DEPHOSPHORYLATION. |
| [18] | "Spatial and temporal regulation of cofilin activity by LIM kinase and Slingshot is critical for directional cell migration." Nishita M., Tomizawa C., Yamamoto M., Horita Y., Ohashi K., Mizuno K. J. Cell Biol. 171:349-359(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [19] | "MAPKAPK-2-mediated LIM-kinase activation is critical for VEGF-induced actin remodeling and cell migration." Kobayashi M., Nishita M., Mishima T., Ohashi K., Mizuno K. EMBO J. 25:713-726(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-323 BY MAPKAPK2. |
| [20] | "Hsp90 increases LIM kinase activity by promoting its homo-dimerization." Li R., Soosairajah J., Harari D., Citri A., Price J., Ng H.L., Morton C.J., Parker M.W., Yarden Y., Bernard O. FASEB J. 20:1218-1220(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HSP90AA1. |
| [21] | "The phosphorylation of p25/TPPP by LIM kinase 1 inhibits its ability to assemble microtubules." Acevedo K., Li R., Soo P., Suryadinata R., Sarcevic B., Valova V.A., Graham M.E., Robinson P.J., Bernard O. Exp. Cell Res. 313:4091-4106(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF TPPP. |
| [22] | "Lim kinases, regulators of actin dynamics." Bernard O. Int. J. Biochem. Cell Biol. 39:1071-1076(2007) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION. |
| [23] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-210; THR-229; SER-310 AND SER-337, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [24] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-307 AND SER-310, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [25] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-210; THR-229; SER-302 AND SER-310, MASS SPECTROMETRY. |
| [26] | "LIM kinases are attractive targets with many macromolecular partners and only a few small molecule regulators." Manetti F. Med. Res. Rev. 0:0-0(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION. |
| [27] | "Nuclear and cytoplasmic LIMK1 enhances human breast cancer progression." McConnell B.V., Koto K., Gutierrez-Hartmann A. Mol. Cancer 10:75-75(2011) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [28] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ALA-190; ASN-247 AND GLN-422. |
| [29] | "Crystal structure of the human limk1 kinase domain in complex with staurosporine." Structural genomics consortium (SGC) Submitted (JUL-2011) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 330-637. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D26309 mRNA. Translation: BAA05371.1. U62293 Genomic DNA. Translation: AAB17545.1. U62293 Genomic DNA. Translation: AAB17546.1. U63721 Genomic DNA. Translation: AAC13885.1. U63721 Genomic DNA. Translation: AAC13886.1. AF134379 mRNA. Translation: AAD25742.1. AK300382 mRNA. Translation: BAH13274.1. AC005056 Genomic DNA. No translation available. AC005057 Genomic DNA. Translation: AAS07438.1. CH471200 Genomic DNA. Translation: EAW69620.1. CH471200 Genomic DNA. Translation: EAW69621.1. CH471200 Genomic DNA. Translation: EAW69622.1. CH471200 Genomic DNA. Translation: EAW69623.1. | ||||||||||||
| IPI | IPI00216433. IPI00216434. IPI00291702. | ||||||||||||
| PIR | JP0078. | ||||||||||||
| RefSeq | NP_001191355.1. NM_001204426.1. NP_002305.1. NM_002314.3. | ||||||||||||
| UniGene | Hs.647035. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P53667. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-31605N. | ||||||||||||
| IntAct | P53667. 9 interactions. | ||||||||||||
| MINT | MINT-2833166. | ||||||||||||
| STRING | 9606.ENSP00000336740. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P53667. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 90185240. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P53667. | ||||||||||||
| PRIDE | P53667. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 3984. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000336180; ENSP00000336740; ENSG00000106683. ENST00000419043; ENSP00000394098; ENSG00000106683. ENST00000435201; ENSP00000414606; ENSG00000106683. ENST00000538333; ENSP00000444452; ENSG00000106683. ENST00000570926; ENSP00000460109; ENSG00000262063. ENST00000571928; ENSP00000460552; ENSG00000262063. ENST00000572388; ENSP00000461249; ENSG00000262063. ENST00000576167; ENSP00000460019; ENSG00000262063. | ||||||||||||
| GeneID | 3984. | ||||||||||||
| KEGG | hsa:3984. | ||||||||||||
| UCSC | uc003uaa.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 3984. | ||||||||||||
| GeneCards | GC07P073497. | ||||||||||||
| HGNC | HGNC:6613. LIMK1. | ||||||||||||
| HPA | HPA028064. HPA028516. | ||||||||||||
| MIM | 601329. gene. | ||||||||||||
| neXtProt | NX_P53667. | ||||||||||||
| Orphanet | 904. Williams syndrome. | ||||||||||||
| PharmGKB | PA30386. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0515. | ||||||||||||
| HOGENOM | HOG000013121. | ||||||||||||
| HOVERGEN | HBG052328. | ||||||||||||
| InParanoid | P53667. | ||||||||||||
| KO | K05743. | ||||||||||||
| PhylomeDB | P53667. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 2.7.11.1. 2681. | ||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. | ||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_127416. Developmental Biology. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P53667. | ||||||||||||
| Bgee | P53667. | ||||||||||||
| CleanEx | HS_LIMK1. | ||||||||||||
| Genevestigator | P53667. | ||||||||||||
| GermOnline | ENSG00000106683. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.10.110.10. 2 hits. | ||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR001478. PDZ. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||
| Pfam | PF00412. LIM. 2 hits. PF00595. PDZ. 1 hit. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00109. TYRKINASE. | ||||||||||||
| SMART | SM00132. LIM. 2 hits. SM00228. PDZ. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. SSF50156. PDZ. 1 hit. | ||||||||||||
| PROSITE | PS00478. LIM_DOMAIN_1. 2 hits. PS50023. LIM_DOMAIN_2. 2 hits. PS50106. PDZ. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P53667. | ||||||||||||
| ChEMBL | CHEMBL3836. | ||||||||||||
| EvolutionaryTrace | P53667. | ||||||||||||
| GenomeRNAi | 3984. | ||||||||||||
| NextBio | 15626. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | LIMK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P53667 Secondary accession number(s): B7Z6I8 Q9Y5Q1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
