P53634 (CATC_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dipeptidyl peptidase 1 EC=3.4.14.1 Alternative name(s): Cathepsin C Cathepsin J Dipeptidyl peptidase I Short name=DPP-I Short name=DPPI Dipeptidyl transferase Cleaved into the following 3 chains:
| ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 463 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Thiol protease. Has dipeptidylpeptidase activity. Active against a broad range of dipeptide substrates composed of both polar and hydrophobic amino acids. Proline cannot occupy the P1 position and arginine cannot occupy the P2 position of the substrate. Can act as both an exopeptidase and endopeptidase. Activates serine proteases such as elastase, cathepsin G and granzymes A and B. Can also activate neuraminidase and factor XIII. Ref.14 |
| Catalytic activity | Release of an N-terminal dipeptide, Xaa-Yaa-|-Zaa-, except when Xaa is Arg or Lys, or Yaa or Zaa is Pro. |
| Cofactor | Binds 1 chloride ion per heavy chain. |
| Enzyme regulation | Strongly inhibited by the cysteine peptidase inhibitors mersalyl acid, iodoacetic acid and cystatin. Inhibited by N-ethylmaleimide, Gly-Phe-diazomethane, TLCK, TPCK and, at low pH, by dithiodipyridine. Not inhibited by the serine peptidase inhibitor PMSF, the aminopeptidase inhibitor bestatin, or metal ion chelators. Ref.14 |
| Subunit structure | Tetramer of heterotrimers consisting of exclusion domain, heavy- and light chains. Ref.14 Ref.17 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Highly expressed in lung, kidney and placenta. Detected at intermediate levels in colon, small intestine, spleen and pancreas. Ref.2 |
| Induction | Up-regulated in lymphocytes by IL2/interleukin-2. Ref.2 Ref.14 |
| Post-translational modification | N-glycosylated. Ref.11 Ref.14 Ref.15 Ref.17 In approximately 50% of the complexes the exclusion domain is cleaved at position 58 or 61. The two parts of the exclusion domain are held together by a disulfide bond. |
| Involvement in disease | Defects in CTSC are a cause of Papillon-Lefevre syndrome (PLS) [MIM:245000]; also known as keratosis palmoplantaris with periodontopathia. PLS is an autosomal recessive disorder characterized by palmoplantar keratosis and severe periodontitis affecting deciduous and permanent dentitions and resulting in premature tooth loss. The palmoplantar keratotic phenotype vary from mild psoriasiform scaly skin to overt hyperkeratosis. Keratosis also affects other sites such as elbows and knees. Ref.3 Ref.4 Ref.18 Ref.20 Ref.21 Ref.22 Ref.23 Ref.24 Ref.25 Ref.26 Ref.27 Ref.28 Defects in CTSC are a cause of Haim-Munk syndrome (HMS) [MIM:245010]; also known as keratosis palmoplantaris with periodontopathia and onychogryposis or Cochin Jewish disorder. HMS is an autosomal recessive disorder characterized by palmoplantar keratosis, onychogryphosis and periodontitis. Additional features are pes planus, arachnodactyly, and acroosteolysis. Ref.19 Defects in CTSC are a cause of aggressive periodontititis type 1 (AP1) [MIM:170650]; also known as juvenile periodontitis (JPD) and prepubertal periodontitis (PPP). AP1 is characterized by severe and protracted gingival infections, leading to tooth loss. AP1 inheritance is autosomal dominant. Ref.20 Ref.26 |
| Sequence similarities | Belongs to the peptidase C1 family. |
| Biophysicochemical properties | pH dependence: High activity at pH 4.5-6.8. Ref.14 |
| Sequence caution | The sequence CAD97897.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Lysosome |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Palmoplantar keratoderma |
| Domain | Signal |
| Ligand | Chloride |
| Molecular function | Hydrolase Protease Thiol protease |
| PTM | Disulfide bond Glycoprotein Zymogen |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | immune response Traceable author statement. Source: ProtInc proteolysisInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | lysosome Traceable author statement Ref.12. Source: UniProtKB |
| Molecular function | cysteine-type endopeptidase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P53634-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P53634-2) The sequence of this isoform differs from the canonical sequence as follows: 107-137: YKEEGSKVTTYCNETMTGWVHDVLGRNWACF → DVTDFISHLFMQLGTVGIYDLPHLRNKLVIK 138-463: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Ref.11 Ref.12 Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 25 – 134 | 110 | Dipeptidyl peptidase 1 exclusion domain chain | PRO_0000026338 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Propeptide | 135 – 230 | 96 | PRO_0000026339 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 231 – 394 | 164 | Dipeptidyl peptidase 1 heavy chain | PRO_0000026340 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 395 – 463 | 69 | Dipeptidyl peptidase 1 light chain | PRO_0000026341 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 258 | 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 405 | 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 427 | 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 302 | 1 | Chloride | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 304 | 1 | Chloride; via amide nitrogen | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 347 | 1 | Chloride | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 29 | 1 | N-linked (GlcNAc...) Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 53 | 1 | N-linked (GlcNAc...) Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 119 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 276 | 1 | N-linked (GlcNAc...) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 30 ↔ 118 | Ref.13 Ref.17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 54 ↔ 136 | Ref.13 Ref.17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 255 ↔ 298 | Ref.13 Ref.17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 291 ↔ 331 | Ref.13 Ref.17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 321 ↔ 337 | Ref.13 Ref.17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 107 – 137 | 31 | YKEEG…NWACF → DVTDFISHLFMQLGTVGIYD LPHLRNKLVIK in isoform 2. | VSP_039123 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 138 – 463 | 326 | Missing in isoform 2. | VSP_039124 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 39 | 1 | W → S in PLS. Ref.22 | VAR_016933 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 67 – 74 | 8 | Missing in PLS. | VAR_019035 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 127 | 1 | H → P in PLS. Ref.23 | VAR_016934 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 129 | 1 | V → E in PLS. Ref.26 | VAR_019036 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 139 | 1 | G → R in PLS. Ref.25 Ref.26 | VAR_019037 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 153 | 1 | I → T. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.6 Ref.9 Ref.14 Ref.21 Ref.23 Ref.25 Ref.26 Corresponds to variant rs217086 [ dbSNP | Ensembl ]. | VAR_016943 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 236 | 1 | D → Y in PLS. Ref.3 Ref.26 | VAR_019038 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 249 | 1 | V → F in PLS. Ref.18 Ref.26 | VAR_009541 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 252 | 1 | Q → L in PLS. Ref.18 Ref.26 | VAR_009542 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 272 | 1 | R → H in PLS. Ref.26 | VAR_019039 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 272 | 1 | R → P in PLS. Ref.18 Ref.21 Ref.23 Ref.24 Ref.25 | VAR_009543 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 286 | 1 | Q → R in HMS and PLS. Ref.3 Ref.19 | VAR_016935 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 291 | 1 | C → Y in PLS. Ref.3 | VAR_019040 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 294 | 1 | Y → H in PLS. Ref.4 | VAR_039686 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 300 | 1 | G → D in PLS. Ref.24 | VAR_019041 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 300 | 1 | G → S in PLS. Ref.21 | VAR_019042 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 301 | 1 | G → S in PLS. Ref.18 Ref.21 Ref.22 Ref.26 | VAR_009544 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 301 | 1 | G → V in PLS. Ref.21 | VAR_019043 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 304 | 1 | Y → N in PLS. Ref.21 | VAR_019044 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 312 | 1 | Q → R in PLS. Ref.26 | VAR_019045 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 319 | 1 | E → G in PLS. Ref.21 | VAR_019046 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 339 | 1 | R → C in PLS. Ref.18 Ref.20 Ref.21 Ref.23 Ref.26 | VAR_009545 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 340 | 1 | Y → C in PLS. Ref.20 Ref.21 | VAR_016944 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 347 | 1 | Y → C in PLS and AP1. Ref.18 Ref.20 Ref.26 | VAR_009546 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 401 | 1 | E → K. Ref.23 | VAR_016945 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 405 | 1 | H → N in PLS. Ref.27 | VAR_027249 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 405 | 1 | H → R in PLS. Ref.28 | VAR_027250 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 412 | 1 | Y → C in AP1. Ref.26 Corresponds to variant rs28937571 [ dbSNP | Ensembl ]. | VAR_019047 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 429 | 1 | W → C in PLS. Ref.23 | VAR_016936 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 447 | 1 | E → G in PLS. Ref.21 Ref.26 | VAR_019048 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 453 | 1 | I → V Rare polymorphism. Ref.22 Corresponds to variant rs3888798 [ dbSNP | Ensembl ]. | VAR_016946 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 63 | 1 | K → I in BAD96758. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 237 | 1 | W → V AA sequence Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 321 | 1 | C → S AA sequence Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 355 | 1 | C → M AA sequence Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 366 | 1 | H → R AA sequence Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 376 – 378 | 3 | VYD → YVY AA sequence Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 32 – 35 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 36 – 43 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 49 – 51 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 62 – 69 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 70 – 72 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 73 – 76 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 81 – 87 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 88 – 90 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 91 – 96 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 99 – 112 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 114 – 121 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 123 – 128 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 133 – 141 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 258 – 274 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 275 – 277 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 285 – 291 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 303 – 306 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 309 – 313 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 319 – 321 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 342 – 347 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 357 – 367 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 370 – 374 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 378 – 381 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 385 – 388 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 405 – 414 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 416 – 418 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 421 – 426 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 438 – 442 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 447 – 449 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 455 – 459 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and sequence analysis of human preprocathepsin C." Paris A., Strukelj B., Pungercar J., Renko M., Dolenc I., Turk V. FEBS Lett. 369:326-330(1995) [PubMed: 7649281] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-153. Tissue: Ileum. |
| [2] | "Human dipeptidyl-peptidase I. Gene characterization, localization, and expression." Rao N.V., Rao G.V., Hoidal J.R. J. Biol. Chem. 272:10260-10265(1997) [PubMed: 9092576] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], INDUCTION, TISSUE SPECIFICITY, VARIANT THR-153. |
| [3] | "Cathepsin C gene: first compound heterozygous patient with Papillon-Lefevre syndrome and a novel symptomless mutation." Allende L.M., Garcia-Perez M.A., Moreno A., Corell A., Carasol M., Martinez-Canut P., Arnaiz-Villena A. Hum. Mutat. 17:152-153(2001) [PubMed: 11180601] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS PLS TYR-236; ARG-286 AND TYR-291, VARIANT THR-153. Tissue: Blood. |
| [4] | "A genetic study of cathepsin C gene in two families with Papillon-Lefevre syndrome." Allende L.M., Moreno A., de Unamuno P. Mol. Genet. Metab. 79:146-148(2003) [PubMed: 12809647] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS THR-153 AND PLS HIS-294. Tissue: Blood. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-153. Tissue: Cerebellum and Rheumatoid arthritic synovial fluid. |
| [6] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-153. Tissue: Thyroid. |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Fetal kidney. |
| [8] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed: 16554811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-153. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Pancreas. |
| [11] | "Stoichiometry and heterogeneity of the pro-region chain in tetrameric human cathepsin C." Cigic B., Krizaj I., Kralj B., Turk V., Pain R.H. Biochim. Biophys. Acta 1382:143-150(1998) [PubMed: 9507095] [Abstract] Cited for: PROTEIN SEQUENCE OF 25-71; 122-143; 231-235 AND 395-399, CHARACTERIZATION OF EXCLUSION DOMAIN, GLYCOSYLATION. |
| [12] | "Oligomeric structure and substrate induced inhibition of human cathepsin C." Dolenc I., Turk B., Pungercic G., Ritonja A., Turk V. J. Biol. Chem. 270:21626-21631(1995) [PubMed: 7665576] [Abstract] Cited for: PROTEIN SEQUENCE OF 25-34; 231-239 AND 395-404, CHARACTERIZATION. |
| [13] | "The residual pro-part of cathepsin C fulfills the criteria required for an intramolecular chaperone in folding and stabilizing the human proenzyme." Cigic B., Dahl S.W., Pain R.H. Biochemistry 39:12382-12390(2000) [PubMed: 11015218] [Abstract] Cited for: PROTEIN SEQUENCE OF 25-28; 51-61; 114-117 AND 133-139, CHARACTERIZATION OF EXCLUSION DOMAIN, DISULFIDE BONDS. |
| [14] | "Purification and characterization of dipeptidyl peptidase I from human spleen." McGuire M.J., Lipsky P.E., Thiele D.L. Arch. Biochem. Biophys. 295:280-288(1992) [PubMed: 1586157] [Abstract] Cited for: PROTEIN SEQUENCE OF 231-290; 310-328 AND 340-383, FUNCTION, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT, GLYCOSYLATION, VARIANT THR-153. Tissue: Spleen. |
| [15] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-53, MASS SPECTROMETRY. Tissue: Liver. |
| [16] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [17] | "Structure of human dipeptidyl peptidase I (cathepsin C): exclusion domain added to an endopeptidase framework creates the machine for activation of granular serine proteases." Turk D., Janjic V., Stern I., Podobnik M., Lamba D., Dahl S.W., Lauritzen C., Pedersen J., Turk V., Turk B. EMBO J. 20:6570-6582(2001) [PubMed: 11726493] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 25-143 AND 231-463 IN COMPLEX WITH CHLORIDE IONS, SUBUNIT, DISULFIDE BONDS, GLYCOSYLATION AT ASN-29. |
| [18] | "Loss-of-function mutations in the cathepsin C gene result in periodontal disease and palmoplantar keratosis." Toomes C., James J., Wood A.J., Wu C.L., McCormick D., Lench N., Hewitt C., Moynihan L., Roberts E., Woods C.G., Markham A., Wong M., Widmer R., Ghaffar K.A., Pemberton M., Hussein I.R., Temtamy S.A., Davies R. Thakker N.S.Nat. Genet. 23:421-424(1999) [PubMed: 10581027] [Abstract] Cited for: VARIANTS PLS PHE-249; LEU-252; PRO-272; SER-301; CYS-339 AND CYS-347. |
| [19] | "Haim-Munk syndrome and Papillon-Lefevre syndrome are allelic mutations in cathepsin C." Hart T.C., Hart P.S., Michalec M.D., Zhang Y., Firatli E., Van Dyke T.E., Stabholz A., Zlotogorski A., Shapira L., Soskolne W.A. J. Med. Genet. 37:88-94(2000) [PubMed: 10662807] [Abstract] Cited for: VARIANT HMS ARG-286. |
| [20] | "Localisation of a gene for prepubertal periodontitis to chromosome 11q14 and identification of a cathepsin C gene mutation." Hart T.C., Hart P.S., Michalec M.D., Zhang Y., Marazita M.L., Cooper M., Yassin O.M., Nusier M., Walker S. J. Med. Genet. 37:95-101(2000) [PubMed: 10662808] [Abstract] Cited for: VARIANTS PLS CYS-339 AND CYS-340, VARIANT AP1 CYS-347. |
| [21] | "Identification of cathepsin C mutations in ethnically diverse Papillon-Lefevre syndrome patients." Hart P.S., Zhang Y., Firatli E., Uygur C., Lotfazar M., Michalec M.D., Marks J.J., Lu X., Coates B.J., Seow W.K., Marshall R., Williams D., Reed J.B., Wright J.T., Hart T.C. J. Med. Genet. 37:927-932(2000) [PubMed: 11106356] [Abstract] Cited for: VARIANTS PLS 67-TYR--ALA-74 DEL; PRO-272; SER-300; VAL-301; SER-301; ASN-304; GLY-319; CYS-339; CYS-340 AND GLY-447, VARIANT THR-153. |
| [22] | "Papillon-Lefevre syndrome: mutations and polymorphisms in the cathepsin C gene." Nakano A., Nomura K., Nakano H., Ono Y., LaForgia S., Pulkkinen L., Hashimoto I., Uitto J. J. Invest. Dermatol. 116:339-343(2001) [PubMed: 11180012] [Abstract] Cited for: VARIANTS PLS SER-39 AND SER-301, VARIANT VAL-453. |
| [23] | "Novel point mutations, deletions, and polymorphisms in the cathepsin C gene in nine families from Europe and North Africa with Papillon-Lefevre syndrome." Lefevre C., Blanchet-Bardon C., Jobard F., Bouadjar B., Stalder J.-F., Cure S., Hoffmann A., Prud'Homme J.-F., Fischer J. J. Invest. Dermatol. 117:1657-1661(2001) [PubMed: 11886537] [Abstract] Cited for: VARIANTS PLS PRO-127; PRO-272; CYS-339 AND CYS-429, VARIANTS THR-153 AND LYS-401. |
| [24] | "Evidence of a founder effect for four cathepsin C gene mutations in Papillon-Lefevre syndrome patients." Zhang Y., Lundgren T., Renvert S., Tatakis D.N., Firatli E., Uygur C., Hart P.S., Gorry M.C., Marks J.J., Hart T.C. J. Med. Genet. 38:96-101(2001) [PubMed: 11158173] [Abstract] Cited for: VARIANTS PLS PRO-272 AND ASP-300. |
| [25] | "Biochemical and mutational analyses of the cathepsin c gene (CTSC) in three North American families with Papillon Lefevre syndrome." Zhang Y., Hart P.S., Moretti A.J., Bouwsma O.J., Fisher E.M., Dudlicek L., Pettenati M.J., Hart T.C. Hum. Mutat. 20:75-75(2002) [PubMed: 12112662] [Abstract] Cited for: VARIANTS PLS ARG-139 AND PRO-272, VARIANT THR-153. |
| [26] | "The role of cathepsin C in Papillon-Lefevre syndrome, prepubertal periodontitis, and aggressive periodontitis." Hewitt C., McCormick D., Linden G., Turk D., Stern I., Wallace I., Southern L., Zhang L., Howard R., Bullon P., Wong M., Widmer R., Gaffar K.A., Awawdeh L., Briggs J., Yaghmai R., Jabs E.W., Hoeger P. Thakker N.S.Hum. Mutat. 23:222-228(2004) [PubMed: 14974080] [Abstract] Cited for: VARIANTS PLS GLU-129; ARG-139; TYR-236; PHE-249; LEU-252; HIS-272; SER-301; ARG-312; CYS-339; CYS-347 AND GLY-447, VARIANTS AP1 HIS-272 AND CYS-412, VARIANT THR-153. |
| [27] | "Loss-of-function mutations in cathepsin C in two families with Papillon-Lefevre syndrome are associated with deficiency of serine proteinases in PMNs." de Haar S.F., Jansen D.C., Schoenmaker T., De Vree H., Everts V., Beertsen W. Hum. Mutat. 23:524-524(2004) [PubMed: 15108292] [Abstract] Cited for: VARIANT PLS ASN-405. |
| [28] | "Gene symbol: CTSC. Disease: Papillon-Lefevre syndrome." de Haar S.F., Mir M., Nguyen M., Kazemi B., Ramezani G.H., Everts V. Hum. Genet. 116:545-545(2005) [PubMed: 15991336] [Abstract] Cited for: VARIANT PLS ARG-405. |
| [29] | Erratum de Haar S.F., Mir M., Nguyen M., Kazemi B., Ramezani G.H., Everts V. Hum. Genet. 118:533-533(2005) |
| + | Additional computationally mapped references. |
Web resources
| CTSCbase CTSC mutation db |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X87212 mRNA. Translation: CAA60671.1. U79415 Genomic DNA. Translation: AAC51341.1. AF234263 mRNA. Translation: AAL48191.1. AF234264 mRNA. Translation: AAL48192.1. AF254757 mRNA. Translation: AAL48195.1. AF525032 mRNA. Translation: AAQ08887.1. AF525033 mRNA. Translation: AAQ08888.1. AK292117 mRNA. Translation: BAF84806.1. AK311923 mRNA. Translation: BAG34864.1. AK223038 mRNA. Translation: BAD96758.1. BX537913 mRNA. Translation: CAD97897.1. Different initiation. AC011088 Genomic DNA. No translation available. CH471185 Genomic DNA. Translation: EAW59364.1. BC054028 mRNA. Translation: AAH54028.1. BC100891 mRNA. Translation: AAI00892.1. BC100892 mRNA. Translation: AAI00893.1. BC100893 mRNA. Translation: AAI00894.1. BC100894 mRNA. Translation: AAI00895.1. BC109386 mRNA. Translation: AAI09387.1. BC110071 mRNA. Translation: AAI10072.1. BC113897 mRNA. Translation: AAI13898.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00022810. IPI00171323. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S23941. S66504. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001805.3. NM_001814.4. NP_680475.1. NM_148170.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.128065. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P53634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P53634. Positions 25-463. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P53634. 7 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-4655964. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P53634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MEROPS | C01.070. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 1705632. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P53634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000227266; ENSP00000227266; ENSG00000109861. ENST00000415415; ENSP00000411027; ENSG00000109861. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 1075. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:1075. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001pck.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 1075. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC11M088026. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0026143. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:2528. CTSC. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB025364. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 170650. phenotype. 245000. phenotype. 245010. phenotype. 602365. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P53634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 2342. Haim-Munk syndrome. 678. Papillon-Lefevre syndrome. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA27028. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG11734. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00560000076599. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG005248. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P53634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | RGTDECA. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4H19VZ. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P53634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BioCyc | MetaCyc:HS03265-MONOMER. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P53634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P53634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P53634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000109861. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR014882. CathepsinC_exc. IPR000169. Pept_cys_AS. IPR013128. Peptidase_C1A. IPR000668. Peptidase_C1A_C. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K01275. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR12411. Peptidase_C1A. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF08773. CathepsinC_exc. 1 hit. PF00112. Peptidase_C1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00705. PAPAIN. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00645. Pept_C1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00640. THIOL_PROTEASE_ASN. 1 hit. PS00139. THIOL_PROTEASE_CYS. 1 hit. PS00639. THIOL_PROTEASE_HIS. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 4488. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P53634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | CATC_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P53634 Secondary accession number(s): A8K7V2 Q8WYA8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with