Reviewed,
UniProtKB/Swiss-Prot P52848 (NDST1_HUMAN)
Last modified
November 3, 2009.
Version 85.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 EC=2.8.2.8 Alternative name(s): Glucosaminyl N-deacetylase/N-sulfotransferase 1 Short name=NDST-1 [Heparan sulfate]-glucosamine N-sulfotransferase 1 Short name=HSNST 1 N-heparan sulfate sulfotransferase 1 Short name=N-HSST 1 Including the following 2 domains: 1- Recommended name: Heparan sulfate N-deacetylase 1 EC=3.-.-.- 2- Recommended name: Heparan sulfate N-sulfotransferase 1 EC=2.8.2.- | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 882 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response. Ref.6 Ref.7 |
| Catalytic activity | 3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-N-sulfoglucosamine. |
| Pathway | |
| Subunit structure | Monomer. |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein. Ref.2 |
| Tissue specificity | Widely expressed. Expression is most abundant in heart, liver and pancreas. |
| Miscellaneous | The presence of 4 different heparan sulfate N-deacetylase/N-sulfotransferase enzymes in mammals, as well as differences in their enzyme activity suggest that some initiate heparan sulfate modification/sulfation reactions, whereas other later on fill in or extend already modified heparan sulfate sequences. |
| Sequence similarities | Belongs to the sulfotransferase 1 family. NDST subfamily. |
| Biophysicochemical properties | Kinetic parameters: KM=13.3 µM for K5 polysaccharide KM=0.35 µM for N-acetylated HS-II |
Ontologies
| Keywords | |
|---|---|
| Biological process | Inflammatory response |
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane |
| Molecular function | Hydrolase Transferase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Multifunctional enzyme |
| Gene Ontology (GO) | |
| Biological process | heparan sulfate proteoglycan biosynthetic process Traceable author statement. Source: ProtInc inflammatory responseInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | Golgi apparatus Inferred from electronic annotation. Source: UniProtKB-KW integral to membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | [heparan sulfate]-glucosamine N-sulfotransferase activity Inferred from electronic annotation. Source: EC hydrolase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P52848-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P52848-2) The sequence of this isoform differs from the canonical sequence as follows: 523-556: ISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNL → VSAPQPMAAGEKGLLHSLSAADTGFLEPGKGGEA 557-882: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 882 | 882 | Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 | PRO_0000085210 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 1 – 17 | 17 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 18 – 39 | 22 | Signal-anchor for type II membrane protein Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 40 – 882 | 843 | Lumenal Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 614 – 618 | 5 | PAPS | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 833 – 837 | 5 | PAPS | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 40 – 598 | 559 | Heparan sulfate N-deacetylase 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 599 – 882 | 284 | Heparan sulfate N-sulfotransferase 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 614 | 1 | For sulfotransferase activity | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 712 | 1 | PAPS | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 231 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 351 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 401 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 667 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 818 ↔ 828 | Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 523 – 556 | 34 | ISIFM…SWTNL → VSAPQPMAAGEKGLLHSLSA ADTGFLEPGKGGEA in isoform 2. | VSP_017397 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 557 – 882 | 326 | Missing in isoform 2. | VSP_017398 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 614 | 1 | K → A: Loss of sulfotransferase activity. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 24 – 28 | 5 | FIFCL → QVVCQ in AAH12888. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 60 | 1 | P → A in AAA67765. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 364 | 1 | H → Q in AAH12888. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 689 | 1 | R → G in AAA67765. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 743 | 1 | K → R in AAA67765. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 604 – 609 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 617 – 625 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 630 – 632 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 637 – 639 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 646 – 648 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 649 – 653 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 655 – 659 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 672 – 676 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 679 – 682 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 686 – 693 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 698 – 703 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 706 – 719 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 723 – 727 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 730 – 734 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 742 – 752 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 753 – 755 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 757 – 765 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 770 – 772 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 773 – 777 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 778 – 783 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 785 – 796 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 805 – 807 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 808 – 811 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 812 – 815 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 816 – 820 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 842 – 866 | 25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 872 – 878 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the human heparan sulfate-N-deacetylase/N-sulfotransferase gene from the Treacher Collins syndrome candidate region at 5q32-q33.1." Dixon J., Loftus S.K., Gladwin A.J., Scambler P.J., Wasmuth J.J., Dixon M.J. Genomics 26:239-244(1995) [PubMed: 7601448] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | "Localization of human heparan glucosaminyl N-deacetylase/N-sulphotransferase to the trans-Golgi network." Humphries D.E., Sullivan B.M., Aleixo M.D., Stow J.L. Biochem. J. 325:351-357(1997) [PubMed: 9230113] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION. Tissue: Umbilical vein endothelial cell. |
| [3] | Labell T.L., Milewicz D.J., Bonadio J., Edelhoff S., Disteche C.M., Byers P.H. Submitted (JUN-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Fibroblast. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lung. |
| [5] | "A role of Lys614 in the sulfotransferase activity of human heparan sulfate N-deacetylase/N-sulfotransferase." Sueyoshi T., Kakuta Y., Pedersen L.C., Wall F.E., Pedersen L.G., Negishi M. FEBS Lett. 433:211-214(1998) [PubMed: 9744796] [Abstract] Cited for: MUTAGENESIS OF LYS-614. |
| [6] | "Overexpression of different isoforms of glucosaminyl N-deacetylase/N-sulfotransferase results in distinct heparan sulfate N-sulfation patterns." Pikas D.S., Eriksson I., Kjellen L. Biochemistry 39:4552-4558(2000) [PubMed: 10758005] [Abstract] Cited for: FUNCTION. |
| [7] | "Antibody-based assay for N-deacetylase activity of heparan sulfate/heparin N-deacetylase/N-sulfotransferase (NDST): novel characteristics of NDST-1 and -2." van den Born J., Pikas D.S., Pisa B.J., Eriksson I., Kjellen L., Berden J.H.M. Glycobiology 13:1-10(2003) [PubMed: 12634318] [Abstract] Cited for: FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES. |
| [8] | "Crystal structure of the sulfotransferase domain of human heparan sulfate N-deacetylase/N-sulfotransferase 1." Kakuta Y., Sueyoshi T., Negishi M., Pedersen L.C. J. Biol. Chem. 274:10673-10676(1999) [PubMed: 10196134] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 579-882 IN COMPLEX WITH PAP, DISULFIDE BOND. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U18918 mRNA. Translation: AAA75281.1. U36600 mRNA. Translation: AAC27354.1. U17970 mRNA. Translation: AAA67765.1. BC012888 mRNA. Translation: AAH12888.1. | |||||||||||||
| IPI | IPI00738468. IPI00784368. | ||||||||||||
| PIR | A57169. | ||||||||||||
| RefSeq | NP_001534.1. | ||||||||||||
| UniGene | Hs.222055 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | P52848. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P52848. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P52848. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000261797; ENSP00000261797; ENSG00000070614; Homo sapiens. [Genome view] ENST00000424060; ENSP00000414827; ENSG00000070614; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 3340. | ||||||||||||
| KEGG | hsa:3340. | ||||||||||||
| UCSC | uc003lsk.2. human. uc003lsl.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 3340. | ||||||||||||
| GeneCards | GC05P149881. | ||||||||||||
| H-InvDB | HIX0005316. | ||||||||||||
| HGNC | HGNC:7680. NDST1. | ||||||||||||
| MIM | 600853. gene. | ||||||||||||
| PharmGKB | PA31486. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | P52848. | ||||||||||||
| OMA | KMGQTLP. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 2.8.2.8. 247. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P52848. | ||||||||||||
| Bgee | P52848. | ||||||||||||
| CleanEx | HS_NDST1. | ||||||||||||
| Genevestigator | P52848. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000863. Sulfotransferase. [Graphical view] | ||||||||||||
| Pfam | PF00685. Sulfotransfer_1. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 13220. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | NDST1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P52848 Secondary accession number(s): Q96E57 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


