Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Beta-chimaerin

Gene

CHN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GTPase-activating protein for p21-rac. Insufficient expression of beta-2 chimaerin is expected to lead to higher Rac activity and could therefore play a role in the progression from low-grade to high-grade tumors.

Enzyme regulationi

In the inactive state, the N terminus protrudes into the active site of the Rho-GAP domain, sterically blocking Rac binding. Phospholipid binding to the Phorbol-ester/DAG-type zinc-finger/C1 domain triggers the cooperative dissociation of these interactions, allowing the N-terminus to move out of the active site and thereby activating the enzyme.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri214 – 26451Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • GTPase activator activity Source: Reactome
  • metal ion binding Source: UniProtKB-KW
  • SH3/SH2 adaptor activity Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-194840. Rho GTPase cycle.
SignaLinkiP52757.
SIGNORiP52757.

Names & Taxonomyi

Protein namesi
Recommended name:
Beta-chimaerin
Alternative name(s):
Beta-chimerin
Rho GTPase-activating protein 3
Gene namesi
Name:CHN2
Synonyms:ARHGAP3, BCH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:1944. CHN2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26474.

Chemistry

ChEMBLiCHEMBL4504.

Polymorphism and mutation databases

BioMutaiCHN2.
DMDMi2506455.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 468468Beta-chimaerinPRO_0000056697Add
BLAST

Proteomic databases

MaxQBiP52757.
PaxDbiP52757.
PeptideAtlasiP52757.
PRIDEiP52757.

PTM databases

iPTMnetiP52757.
PhosphoSiteiP52757.

Expressioni

Tissue specificityi

Highest levels in the brain and pancreas. Also expressed in the heart, placenta, and weakly in the kidney and liver. Expression is much reduced in the malignant gliomas, compared to normal brain or low-grade astrocytomas.

Gene expression databases

BgeeiENSG00000106069.
CleanExiHS_CHN2.
ExpressionAtlasiP52757. baseline and differential.
GenevisibleiP52757. HS.

Organism-specific databases

HPAiHPA018989.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
RAC1P630004EBI-714925,EBI-413628

GO - Molecular functioni

  • SH3/SH2 adaptor activity Source: ProtInc

Protein-protein interaction databases

BioGridi107548. 9 interactions.
IntActiP52757. 9 interactions.
MINTiMINT-1420866.
STRINGi9606.ENSP00000222792.

Chemistry

BindingDBiP52757.

Structurei

Secondary structure

1
468
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi29 – 368Combined sources
Beta strandi58 – 636Combined sources
Helixi66 – 738Combined sources
Beta strandi79 – 846Combined sources
Beta strandi86 – 883Combined sources
Beta strandi92 – 987Combined sources
Beta strandi101 – 1044Combined sources
Beta strandi108 – 1147Combined sources
Beta strandi116 – 1183Combined sources
Helixi125 – 13814Combined sources
Helixi141 – 1466Combined sources
Helixi153 – 1553Combined sources
Beta strandi156 – 1616Combined sources
Turni229 – 2313Combined sources
Turni237 – 2404Combined sources
Beta strandi246 – 2483Combined sources
Helixi255 – 2573Combined sources
Turni266 – 2694Combined sources
Helixi279 – 2868Combined sources
Helixi292 – 30312Combined sources
Beta strandi306 – 3083Combined sources
Turni309 – 3135Combined sources
Helixi318 – 32811Combined sources
Turni331 – 3344Combined sources
Beta strandi339 – 3424Combined sources
Helixi346 – 35813Combined sources
Helixi369 – 3735Combined sources
Turni374 – 3774Combined sources
Helixi381 – 39212Combined sources
Helixi397 – 4059Combined sources
Turni406 – 4105Combined sources
Helixi411 – 4144Combined sources
Turni415 – 4195Combined sources
Helixi424 – 4318Combined sources
Turni432 – 4343Combined sources
Helixi445 – 4484Combined sources
Helixi450 – 46213Combined sources
Helixi464 – 4674Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1XA6X-ray3.20A7-468[»]
ProteinModelPortaliP52757.
SMRiP52757. Positions 23-468.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP52757.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini59 – 12769SH2PROSITE-ProRule annotationAdd
BLAST
Domaini277 – 468192Rho-GAPPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation
Contains 1 SH2 domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri214 – 26451Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

SH2 domain, Zinc-finger

Phylogenomic databases

eggNOGiKOG1453. Eukaryota.
ENOG410YM3I. LUCA.
GeneTreeiENSGT00840000129703.
HOGENOMiHOG000231926.
HOVERGENiHBG080489.
InParanoidiP52757.
OMAiIICPGEV.
OrthoDBiEOG091G0834.
PhylomeDBiP52757.
TreeFamiTF342052.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
3.30.505.10. 1 hit.
InterProiIPR017356. CHN1/CHN2.
IPR020454. DAG/PE-bd.
IPR002219. PE/DAG-bd.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR000980. SH2.
[Graphical view]
PfamiPF00130. C1_1. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
PIRSFiPIRSF038015. N-chimaerin. 1 hit.
PRINTSiPR00008. DAGPEDOMAIN.
SMARTiSM00109. C1. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS50238. RHOGAP. 1 hit.
PS50001. SH2. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Beta-2 (identifier: P52757-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAASSNSSLS GSSVSSDAEE YQPPIWKSYL YQLQQEAPRP KRIICPREVE
60 70 80 90 100
NRPKYYGREF HGIISREQAD ELLGGVEGAY ILRESQRQPG CYTLALRFGN
110 120 130 140 150
QTLNYRLFHD GKHFVGEKRF ESIHDLVTDG LITLYIETKA AEYISKMTTN
160 170 180 190 200
PIYEHIGYAT LLREKVSRRL SRSKNEPRKT NVTHEEHTAV EKISSLVRRA
210 220 230 240 250
ALTHNDNHFN YEKTHNFKVH TFRGPHWCEY CANFMWGLIA QGVRCSDCGL
260 270 280 290 300
NVHKQCSKHV PNDCQPDLKR IKKVYCCDLT TLVKAHNTQR PMVVDICIRE
310 320 330 340 350
IEARGLKSEG LYRVSGFTEH IEDVKMAFDR DGEKADISAN VYPDINIITG
360 370 380 390 400
ALKLYFRDLP IPVITYDTYS KFIDAAKISN ADERLEAVHE VLMLLPPAHY
410 420 430 440 450
ETLRYLMIHL KKVTMNEKDN FMNAENLGIV FGPTLMRPPE DSTLTTLHDM
460
RYQKLIVQIL IENEDVLF
Length:468
Mass (Da):53,924
Last modified:November 1, 1997 - v2
Checksum:i63254958E0B5804C
GO
Isoform Beta-1 (identifier: P52757-2)
Sequence is not available
Length:
Mass (Da):
Isoform 3 (identifier: P52757-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MAASSNSSLS...REVENRPKYY → MFSEELWLEN...PPLKLFACSQ
     57-192: Missing.

Note: No experimental confirmation available.
Show »
Length:332
Mass (Da):38,178
Checksum:i7A2B5C42F1769425
GO
Isoform 4 (identifier: P52757-4) [UniParc]FASTAAdd to basket
Also known as: B1-CHNdel ex7p

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQE → MFSEELWLENEKKCAVVRKSKQGRKRQELLAVAFGV
     37-217: Missing.

Show »
Length:287
Mass (Da):33,053
Checksum:i919FF9A301706C6E
GO
Isoform 5 (identifier: P52757-5) [UniParc]FASTAAdd to basket
Also known as: B1-CHNdel ex9

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MAASSNSSLS...REVENRPKYY → MFSEELWLEN...PPLKLFACSQ
     57-192: Missing.
     247-304: Missing.

Show »
Length:274
Mass (Da):31,518
Checksum:i4216F583B958B41F
GO
Isoform 6 (identifier: P52757-6) [UniParc]FASTAAdd to basket
Also known as: B1-CHNdel ex7p,11

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQE → MFSEELWLENEKKCAVVRKSKQGRKRQELLAVAFGV
     37-217: Missing.
     331-377: DGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAK → E

Show »
Length:241
Mass (Da):27,951
Checksum:iD1E415379991433D
GO
Isoform 7 (identifier: P52757-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MAASSNSSLS...REVENRPKYY → MFSEELWLEN...PPLKLFACSQ
     57-192: Missing.
     331-377: DGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAK → E

Show »
Length:286
Mass (Da):33,075
Checksum:i8831F1DAC250619E
GO
Isoform 8 (identifier: P52757-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-192: Missing.

Show »
Length:324
Mass (Da):37,199
Checksum:i9E131257B687487F
GO
Isoform Beta-3 (identifier: P52757-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MAASSNSSLSGSSVS → MTQTHRAKSA...FADGLHSSCT

Show »
Length:543
Mass (Da):62,441
Checksum:i5EDA9330E0F66530
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1 – 66MAASSN → MRLL in AAA16836 (PubMed:8175705).Curated
Sequence conflicti1 – 66MAASSN → MRLL in AAA19191 (PubMed:8175705).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti204 – 2041H → R.1 Publication
Corresponds to variant rs3750103 [ dbSNP | Ensembl ].
VAR_022118
Natural varianti438 – 4381P → S.
Corresponds to variant rs34971642 [ dbSNP | Ensembl ].
VAR_049136

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5656MAASS…RPKYY → MFSEELWLENEKKCAVVRKS KQGRKRQELLAVAFGVKVGV KGGFLWPPLKLFACSQ in isoform 3, isoform 5 and isoform 7. 2 PublicationsVSP_046271Add
BLAST
Alternative sequencei1 – 3636MAASS…QLQQE → MFSEELWLENEKKCAVVRKS KQGRKRQELLAVAFGV in isoform 4 and isoform 6. 2 PublicationsVSP_047600Add
BLAST
Alternative sequencei1 – 1515MAASS…GSSVS → MTQTHRAKSASSCPNLLVPE TWPHQVSASHAGRSKQPQGG ILKINEEHRRGAIQDLLASP GFTFGKRVVFDSHCLKRQHT FADGLHSSCT in isoform Beta-3. 1 PublicationVSP_053679Add
BLAST
Alternative sequencei37 – 217181Missing in isoform 4 and isoform 6. 2 PublicationsVSP_047601Add
BLAST
Alternative sequencei49 – 192144Missing in isoform 8. 1 PublicationVSP_053323Add
BLAST
Alternative sequencei57 – 192136Missing in isoform 3, isoform 5 and isoform 7. 2 PublicationsVSP_046272Add
BLAST
Alternative sequencei247 – 30458Missing in isoform 5. 1 PublicationVSP_047602Add
BLAST
Alternative sequencei331 – 37747DGEKA…IDAAK → E in isoform 6 and isoform 7. 1 PublicationVSP_047603Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L29126 mRNA. Translation: AAA19191.1.
U07223 mRNA. Translation: AAA16836.1.
U28926 mRNA. Translation: AAA86528.1.
EU732752 mRNA. Translation: ACF04989.1.
EU732753 mRNA. Translation: ACF04990.1.
EU732754 mRNA. Translation: ACF04991.1.
EU732758 mRNA. Translation: ACF04995.1.
EU732762 mRNA. Translation: ACF04999.1.
GQ924106 mRNA. Translation: ADK47390.1.
AK026415 mRNA. No translation available.
AK313021 mRNA. Translation: BAG35856.1.
AK316030 mRNA. Translation: BAH14401.1.
AC004417 Genomic DNA. Translation: AAC06177.1.
AC004593 Genomic DNA. No translation available.
AC005232 Genomic DNA. No translation available.
AC007096 Genomic DNA. No translation available.
AC007255 Genomic DNA. Translation: AAS07498.1.
CH236948 Genomic DNA. Translation: EAL24205.1.
CH471073 Genomic DNA. Translation: EAW93919.1.
BC112155 mRNA. Translation: AAI12156.1.
CCDSiCCDS47566.1. [P52757-3]
CCDS5420.1. [P52757-1]
CCDS78219.1. [P52757-5]
PIRiA53764.
RefSeqiNP_001035025.1. NM_001039936.2. [P52757-3]
NP_001279998.1. NM_001293069.1. [P52757-9]
NP_001279999.1. NM_001293070.1.
NP_001280000.1. NM_001293071.1.
NP_001280002.1. NM_001293073.1. [P52757-4]
NP_001280004.1. NM_001293075.1. [P52757-6]
NP_001280005.1. NM_001293076.1. [P52757-5]
NP_001280006.1. NM_001293077.1.
NP_001280007.1. NM_001293078.1.
NP_001280008.1. NM_001293079.1.
NP_001280009.1. NM_001293080.1. [P52757-7]
NP_004058.1. NM_004067.3. [P52757-1]
UniGeneiHs.654611.
Hs.710429.
Hs.734596.

Genome annotation databases

EnsembliENST00000222792; ENSP00000222792; ENSG00000106069. [P52757-1]
ENST00000412711; ENSP00000486515; ENSG00000106069. [P52757-3]
ENST00000421775; ENSP00000394284; ENSG00000106069. [P52757-5]
GeneIDi1124.
KEGGihsa:1124.
UCSCiuc003szz.4. human. [P52757-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L29126 mRNA. Translation: AAA19191.1.
U07223 mRNA. Translation: AAA16836.1.
U28926 mRNA. Translation: AAA86528.1.
EU732752 mRNA. Translation: ACF04989.1.
EU732753 mRNA. Translation: ACF04990.1.
EU732754 mRNA. Translation: ACF04991.1.
EU732758 mRNA. Translation: ACF04995.1.
EU732762 mRNA. Translation: ACF04999.1.
GQ924106 mRNA. Translation: ADK47390.1.
AK026415 mRNA. No translation available.
AK313021 mRNA. Translation: BAG35856.1.
AK316030 mRNA. Translation: BAH14401.1.
AC004417 Genomic DNA. Translation: AAC06177.1.
AC004593 Genomic DNA. No translation available.
AC005232 Genomic DNA. No translation available.
AC007096 Genomic DNA. No translation available.
AC007255 Genomic DNA. Translation: AAS07498.1.
CH236948 Genomic DNA. Translation: EAL24205.1.
CH471073 Genomic DNA. Translation: EAW93919.1.
BC112155 mRNA. Translation: AAI12156.1.
CCDSiCCDS47566.1. [P52757-3]
CCDS5420.1. [P52757-1]
CCDS78219.1. [P52757-5]
PIRiA53764.
RefSeqiNP_001035025.1. NM_001039936.2. [P52757-3]
NP_001279998.1. NM_001293069.1. [P52757-9]
NP_001279999.1. NM_001293070.1.
NP_001280000.1. NM_001293071.1.
NP_001280002.1. NM_001293073.1. [P52757-4]
NP_001280004.1. NM_001293075.1. [P52757-6]
NP_001280005.1. NM_001293076.1. [P52757-5]
NP_001280006.1. NM_001293077.1.
NP_001280007.1. NM_001293078.1.
NP_001280008.1. NM_001293079.1.
NP_001280009.1. NM_001293080.1. [P52757-7]
NP_004058.1. NM_004067.3. [P52757-1]
UniGeneiHs.654611.
Hs.710429.
Hs.734596.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1XA6X-ray3.20A7-468[»]
ProteinModelPortaliP52757.
SMRiP52757. Positions 23-468.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107548. 9 interactions.
IntActiP52757. 9 interactions.
MINTiMINT-1420866.
STRINGi9606.ENSP00000222792.

Chemistry

BindingDBiP52757.
ChEMBLiCHEMBL4504.

PTM databases

iPTMnetiP52757.
PhosphoSiteiP52757.

Polymorphism and mutation databases

BioMutaiCHN2.
DMDMi2506455.

Proteomic databases

MaxQBiP52757.
PaxDbiP52757.
PeptideAtlasiP52757.
PRIDEiP52757.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000222792; ENSP00000222792; ENSG00000106069. [P52757-1]
ENST00000412711; ENSP00000486515; ENSG00000106069. [P52757-3]
ENST00000421775; ENSP00000394284; ENSG00000106069. [P52757-5]
GeneIDi1124.
KEGGihsa:1124.
UCSCiuc003szz.4. human. [P52757-1]

Organism-specific databases

CTDi1124.
GeneCardsiCHN2.
HGNCiHGNC:1944. CHN2.
HPAiHPA018989.
MIMi602857. gene.
neXtProtiNX_P52757.
PharmGKBiPA26474.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1453. Eukaryota.
ENOG410YM3I. LUCA.
GeneTreeiENSGT00840000129703.
HOGENOMiHOG000231926.
HOVERGENiHBG080489.
InParanoidiP52757.
OMAiIICPGEV.
OrthoDBiEOG091G0834.
PhylomeDBiP52757.
TreeFamiTF342052.

Enzyme and pathway databases

ReactomeiR-HSA-194840. Rho GTPase cycle.
SignaLinkiP52757.
SIGNORiP52757.

Miscellaneous databases

ChiTaRSiCHN2. human.
EvolutionaryTraceiP52757.
GeneWikiiChimerin_2.
GenomeRNAii1124.
PROiP52757.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000106069.
CleanExiHS_CHN2.
ExpressionAtlasiP52757. baseline and differential.
GenevisibleiP52757. HS.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
3.30.505.10. 1 hit.
InterProiIPR017356. CHN1/CHN2.
IPR020454. DAG/PE-bd.
IPR002219. PE/DAG-bd.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR000980. SH2.
[Graphical view]
PfamiPF00130. C1_1. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
PIRSFiPIRSF038015. N-chimaerin. 1 hit.
PRINTSiPR00008. DAGPEDOMAIN.
SMARTiSM00109. C1. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS50238. RHOGAP. 1 hit.
PS50001. SH2. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCHIO_HUMAN
AccessioniPrimary (citable) accession number: P52757
Secondary accession number(s): A4D1A2
, B3VCF1, B3VCF2, B3VCF3, B3VCF7, B3VCG1, C9J7B0, E9PGE0, F8QPL9, Q2M203, Q75MM2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 1, 1997
Last modified: September 7, 2016
This is version 170 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.