Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P52744

- ZN138_HUMAN

UniProt

P52744 - ZN138_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 138

Gene

ZNF138

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation as a repressor.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri110 – 13223C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri138 – 16023C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri166 – 18823C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri194 – 21623C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri222 – 24423C2H2-type 5; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri250 – 26213C2H2-type 6; degeneratePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. sequence-specific DNA binding transcription factor activity Source: UniProtKB

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: UniProtKB
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_12627. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 138
Gene namesi
Name:ZNF138
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:12922. ZNF138.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37510.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 262262Zinc finger protein 138PRO_0000047422Add
BLAST

Proteomic databases

PaxDbiP52744.
PRIDEiP52744.

PTM databases

PhosphoSiteiP52744.

Expressioni

Gene expression databases

BgeeiP52744.
CleanExiHS_ZNF138.
ExpressionAtlasiP52744. baseline and differential.
GenevestigatoriP52744.

Structurei

3D structure databases

ProteinModelPortaliP52744.
SMRiP52744. Positions 94-262.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 6 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri110 – 13223C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri138 – 16023C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri166 – 18823C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri194 – 21623C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri222 – 24423C2H2-type 5; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri250 – 26213C2H2-type 6; degeneratePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00550000074383.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiP52744.
PhylomeDBiP52744.
TreeFamiTF342117.

Family and domain databases

Gene3Di3.30.160.60. 6 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 2 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P52744-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKRHEMVVAK HSALCSRFAQ DLWLEQNIKD SFQKVTLSRY GKYGHKNLQL
60 70 80 90 100
RKGCKSVDEC KGHQGGFNGL NQCLKITTSK IFQCNKYVKV MHKFSNSNRH
110 120 130 140 150
KIRHTENKHF RCKECDKSLC MLSRLTQHKK IHTRENFYKC EECGKTFNWS
160 170 180 190 200
TNLSKPKKIH TGEKPYKCEV CGKAFHQSSI LTKHKIIRTG EKPYKCAHCG
210 220 230 240 250
KAFKQSSHLT RHKIIHTEEK PYKCEQCGKV FKQSPTLTKH QIIYTGEEPY
260
KCEECGKAFN LS
Length:262
Mass (Da):30,592
Last modified:July 10, 2007 - v2
Checksum:iD2B463F0E584ACE6
GO
Isoform 2 (identifier: P52744-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MKRHEMVVAKHS → MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFL

Note: No experimental confirmation available.Curated

Show »
Length:293
Mass (Da):34,333
Checksum:i75A81E4094BBDD30
GO
Isoform 3 (identifier: P52744-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MKRHEMVVAKHS → MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFL
     13-95: ALCSRFAQDL...KYVKVMHKFS → DLITCLEQGK...CVLVLPKTFG
     96-262: Missing.

Show »
Length:126
Mass (Da):14,597
Checksum:i0E5685E757EEEBBD
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti22 – 232LW → KG in AAC50263. (PubMed:7557990)Curated
Sequence conflicti67 – 671F → Y in AK055644. (PubMed:14702039)Curated
Sequence conflicti67 – 671F → Y in BAG60499. (PubMed:14702039)Curated
Sequence conflicti67 – 671F → Y in AAC50263. (PubMed:7557990)Curated
Isoform 2 (identifier: P52744-2)
Sequence conflicti33 – 331M → V in BAG60499. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti62 – 621G → E.2 Publications
Corresponds to variant rs10949946 [ dbSNP | Ensembl ].
VAR_057398

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1212MKRHE…VAKHS → MGPLTFMDVAIEFSLEEWQC LDTAQRNVYRHVMLENYRNL VFL in isoform 2 and isoform 3. 1 PublicationVSP_044921Add
BLAST
Alternative sequencei13 – 9583ALCSR…MHKFS → DLITCLEQGKEPWNMKRHEM VVAKHSAVAFTYDLSGLNIL SFQSILPFVSALYVMGNRNQ CLQKHLEARNKDLCVLVLPK TFG in isoform 3. 1 PublicationVSP_047446Add
BLAST
Alternative sequencei96 – 262167Missing in isoform 3. 1 PublicationVSP_047447Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055644 mRNA. No translation available.
AK294302 mRNA. Translation: BAG57583.1.
AK298230 mRNA. Translation: BAG60499.1.
AC073349 Genomic DNA. No translation available.
U09847 mRNA. Translation: AAC50263.1.
CCDSiCCDS34645.2. [P52744-2]
CCDS55115.1. [P52744-3]
PIRiI38615.
RefSeqiNP_001153655.1. NM_001160183.2.
NP_001258566.1. NM_001271637.1.
NP_006515.2. NM_006524.3.
UniGeneiHs.184080.

Genome annotation databases

EnsembliENST00000440155; ENSP00000407262; ENSG00000197008. [P52744-2]
GeneIDi7697.
KEGGihsa:7697.
UCSCiuc003tth.4. human. [P52744-1]

Polymorphism databases

DMDMi152031767.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055644 mRNA. No translation available.
AK294302 mRNA. Translation: BAG57583.1 .
AK298230 mRNA. Translation: BAG60499.1 .
AC073349 Genomic DNA. No translation available.
U09847 mRNA. Translation: AAC50263.1 .
CCDSi CCDS34645.2. [P52744-2 ]
CCDS55115.1. [P52744-3 ]
PIRi I38615.
RefSeqi NP_001153655.1. NM_001160183.2.
NP_001258566.1. NM_001271637.1.
NP_006515.2. NM_006524.3.
UniGenei Hs.184080.

3D structure databases

ProteinModelPortali P52744.
SMRi P52744. Positions 94-262.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei P52744.

Polymorphism databases

DMDMi 152031767.

Proteomic databases

PaxDbi P52744.
PRIDEi P52744.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000440155 ; ENSP00000407262 ; ENSG00000197008 . [P52744-2 ]
GeneIDi 7697.
KEGGi hsa:7697.
UCSCi uc003tth.4. human. [P52744-1 ]

Organism-specific databases

CTDi 7697.
GeneCardsi GC07P064254.
HGNCi HGNC:12922. ZNF138.
MIMi 604080. gene.
neXtProti NX_P52744.
PharmGKBi PA37510.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
GeneTreei ENSGT00550000074383.
HOGENOMi HOG000234617.
HOVERGENi HBG018163.
InParanoidi P52744.
PhylomeDBi P52744.
TreeFami TF342117.

Enzyme and pathway databases

Reactomei REACT_12627. Generic Transcription Pathway.

Miscellaneous databases

GenomeRNAii 7697.
NextBioi 29838.
PROi P52744.
SOURCEi Search...

Gene expression databases

Bgeei P52744.
CleanExi HS_ZNF138.
ExpressionAtlasi P52744. baseline and differential.
Genevestigatori P52744.

Family and domain databases

Gene3Di 3.30.160.60. 6 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 5 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 2 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT GLU-62.
    Tissue: Amygdala.
  2. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders."
    Tommerup N., Vissing H.
    Genomics 27:259-264(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 22-260 (ISOFORM 1), VARIANT GLU-62.
    Tissue: Insulinoma.

Entry informationi

Entry nameiZN138_HUMAN
AccessioniPrimary (citable) accession number: P52744
Secondary accession number(s): B4DFX2
, B4DP87, E9PHI7, E9PHK7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: July 10, 2007
Last modified: October 29, 2014
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3