Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P52744

- ZN138_HUMAN

UniProt

P52744 - ZN138_HUMAN

Protein

Zinc finger protein 138

Gene

ZNF138

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 2 (10 Jul 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in transcriptional regulation as a repressor.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri110 – 13223C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri138 – 16023C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri166 – 18823C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri194 – 21623C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri222 – 24423C2H2-type 5; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri250 – 26213C2H2-type 6; degeneratePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW
    3. sequence-specific DNA binding transcription factor activity Source: UniProtKB

    GO - Biological processi

    1. regulation of transcription, DNA-templated Source: UniProtKB
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_12627. Generic Transcription Pathway.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 138
    Gene namesi
    Name:ZNF138
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:12922. ZNF138.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37510.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 262262Zinc finger protein 138PRO_0000047422Add
    BLAST

    Proteomic databases

    PaxDbiP52744.
    PRIDEiP52744.

    PTM databases

    PhosphoSiteiP52744.

    Expressioni

    Gene expression databases

    ArrayExpressiP52744.
    BgeeiP52744.
    CleanExiHS_ZNF138.
    GenevestigatoriP52744.

    Structurei

    3D structure databases

    ProteinModelPortaliP52744.
    SMRiP52744. Positions 94-262.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Contains 6 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri110 – 13223C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri138 – 16023C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri166 – 18823C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri194 – 21623C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri222 – 24423C2H2-type 5; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri250 – 26213C2H2-type 6; degeneratePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOGENOMiHOG000234617.
    HOVERGENiHBG018163.
    InParanoidiP52744.
    PhylomeDBiP52744.
    TreeFamiTF342117.

    Family and domain databases

    Gene3Di3.30.160.60. 6 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 5 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 2 hits.
    PS50157. ZINC_FINGER_C2H2_2. 6 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P52744-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKRHEMVVAK HSALCSRFAQ DLWLEQNIKD SFQKVTLSRY GKYGHKNLQL    50
    RKGCKSVDEC KGHQGGFNGL NQCLKITTSK IFQCNKYVKV MHKFSNSNRH 100
    KIRHTENKHF RCKECDKSLC MLSRLTQHKK IHTRENFYKC EECGKTFNWS 150
    TNLSKPKKIH TGEKPYKCEV CGKAFHQSSI LTKHKIIRTG EKPYKCAHCG 200
    KAFKQSSHLT RHKIIHTEEK PYKCEQCGKV FKQSPTLTKH QIIYTGEEPY 250
    KCEECGKAFN LS 262
    Length:262
    Mass (Da):30,592
    Last modified:July 10, 2007 - v2
    Checksum:iD2B463F0E584ACE6
    GO
    Isoform 2 (identifier: P52744-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-12: MKRHEMVVAKHS → MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFL

    Note: No experimental confirmation available.Curated

    Show »
    Length:293
    Mass (Da):34,333
    Checksum:i75A81E4094BBDD30
    GO
    Isoform 3 (identifier: P52744-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-12: MKRHEMVVAKHS → MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFL
         13-95: ALCSRFAQDL...KYVKVMHKFS → DLITCLEQGK...CVLVLPKTFG
         96-262: Missing.

    Show »
    Length:126
    Mass (Da):14,597
    Checksum:i0E5685E757EEEBBD
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti22 – 232LW → KG in AAC50263. (PubMed:7557990)Curated
    Sequence conflicti67 – 671F → Y in AK055644. (PubMed:14702039)Curated
    Sequence conflicti67 – 671F → Y in BAG60499. (PubMed:14702039)Curated
    Sequence conflicti67 – 671F → Y in AAC50263. (PubMed:7557990)Curated
    Isoform 2 (identifier: P52744-2)
    Sequence conflicti33 – 331M → V in BAG60499. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti62 – 621G → E.2 Publications
    Corresponds to variant rs10949946 [ dbSNP | Ensembl ].
    VAR_057398

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1212MKRHE…VAKHS → MGPLTFMDVAIEFSLEEWQC LDTAQRNVYRHVMLENYRNL VFL in isoform 2 and isoform 3. 1 PublicationVSP_044921Add
    BLAST
    Alternative sequencei13 – 9583ALCSR…MHKFS → DLITCLEQGKEPWNMKRHEM VVAKHSAVAFTYDLSGLNIL SFQSILPFVSALYVMGNRNQ CLQKHLEARNKDLCVLVLPK TFG in isoform 3. 1 PublicationVSP_047446Add
    BLAST
    Alternative sequencei96 – 262167Missing in isoform 3. 1 PublicationVSP_047447Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK055644 mRNA. No translation available.
    AK294302 mRNA. Translation: BAG57583.1.
    AK298230 mRNA. Translation: BAG60499.1.
    AC073349 Genomic DNA. No translation available.
    U09847 mRNA. Translation: AAC50263.1.
    CCDSiCCDS34645.2. [P52744-2]
    CCDS55115.1. [P52744-3]
    PIRiI38615.
    RefSeqiNP_001153655.1. NM_001160183.2.
    NP_001258566.1. NM_001271637.1.
    NP_006515.2. NM_006524.3.
    UniGeneiHs.184080.

    Genome annotation databases

    EnsembliENST00000359735; ENSP00000352770; ENSG00000197008. [P52744-1]
    ENST00000440155; ENSP00000407262; ENSG00000197008. [P52744-2]
    GeneIDi7697.
    KEGGihsa:7697.
    UCSCiuc003tth.4. human. [P52744-1]

    Polymorphism databases

    DMDMi152031767.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK055644 mRNA. No translation available.
    AK294302 mRNA. Translation: BAG57583.1 .
    AK298230 mRNA. Translation: BAG60499.1 .
    AC073349 Genomic DNA. No translation available.
    U09847 mRNA. Translation: AAC50263.1 .
    CCDSi CCDS34645.2. [P52744-2 ]
    CCDS55115.1. [P52744-3 ]
    PIRi I38615.
    RefSeqi NP_001153655.1. NM_001160183.2.
    NP_001258566.1. NM_001271637.1.
    NP_006515.2. NM_006524.3.
    UniGenei Hs.184080.

    3D structure databases

    ProteinModelPortali P52744.
    SMRi P52744. Positions 94-262.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei P52744.

    Polymorphism databases

    DMDMi 152031767.

    Proteomic databases

    PaxDbi P52744.
    PRIDEi P52744.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000359735 ; ENSP00000352770 ; ENSG00000197008 . [P52744-1 ]
    ENST00000440155 ; ENSP00000407262 ; ENSG00000197008 . [P52744-2 ]
    GeneIDi 7697.
    KEGGi hsa:7697.
    UCSCi uc003tth.4. human. [P52744-1 ]

    Organism-specific databases

    CTDi 7697.
    GeneCardsi GC07P064254.
    HGNCi HGNC:12922. ZNF138.
    MIMi 604080. gene.
    neXtProti NX_P52744.
    PharmGKBi PA37510.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOGENOMi HOG000234617.
    HOVERGENi HBG018163.
    InParanoidi P52744.
    PhylomeDBi P52744.
    TreeFami TF342117.

    Enzyme and pathway databases

    Reactomei REACT_12627. Generic Transcription Pathway.

    Miscellaneous databases

    GenomeRNAii 7697.
    NextBioi 29838.
    PROi P52744.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P52744.
    Bgeei P52744.
    CleanExi HS_ZNF138.
    Genevestigatori P52744.

    Family and domain databases

    Gene3Di 3.30.160.60. 6 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 5 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 2 hits.
    PS50157. ZINC_FINGER_C2H2_2. 6 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT GLU-62.
      Tissue: Amygdala.
    2. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders."
      Tommerup N., Vissing H.
      Genomics 27:259-264(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 22-260 (ISOFORM 1), VARIANT GLU-62.
      Tissue: Insulinoma.

    Entry informationi

    Entry nameiZN138_HUMAN
    AccessioniPrimary (citable) accession number: P52744
    Secondary accession number(s): B4DFX2
    , B4DP87, E9PHI7, E9PHK7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: July 10, 2007
    Last modified: October 1, 2014
    This is version 120 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3