Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 138

Gene

ZNF138

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation as a repressor.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri110 – 132C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri138 – 160C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri166 – 188C2H2-type 3; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri194 – 216C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri222 – 244C2H2-type 5; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri250 – 262C2H2-type 6; degeneratePROSITE-ProRule annotationAdd BLAST13

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW
  • transcription factor activity, sequence-specific DNA binding Source: UniProtKB

GO - Biological processi

  • regulation of transcription, DNA-templated Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 138
Gene namesi
Name:ZNF138
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:12922. ZNF138.

Subcellular locationi

GO - Cellular componenti

  • nucleus Source: UniProtKB

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi7697.
OpenTargetsiENSG00000197008.
PharmGKBiPA37510.

Polymorphism and mutation databases

DMDMi152031767.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000474221 – 262Zinc finger protein 138Add BLAST262

Proteomic databases

PaxDbiP52744.
PeptideAtlasiP52744.
PRIDEiP52744.

PTM databases

iPTMnetiP52744.
PhosphoSitePlusiP52744.

Expressioni

Gene expression databases

BgeeiENSG00000197008.
CleanExiHS_ZNF138.
ExpressionAtlasiP52744. baseline and differential.

Organism-specific databases

HPAiHPA077435.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi113492. 7 interactors.
IntActiP52744. 11 interactors.
STRINGi9606.ENSP00000407262.

Structurei

3D structure databases

ProteinModelPortaliP52744.
SMRiP52744.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri110 – 132C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri138 – 160C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri166 – 188C2H2-type 3; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri194 – 216C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri222 – 244C2H2-type 5; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri250 – 262C2H2-type 6; degeneratePROSITE-ProRule annotationAdd BLAST13

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00890000139354.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiP52744.
PhylomeDBiP52744.
TreeFamiTF342117.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiView protein in InterPro
IPR013087. Znf_C2H2_type.
IPR013083. Znf_RING/FYVE/PHD.
SMARTiView protein in SMART
SM00355. ZnF_C2H2. 5 hits.
SUPFAMiSSF57667. SSF57667. 3 hits.
PROSITEiView protein in PROSITE
PS00028. ZINC_FINGER_C2H2_1. 2 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P52744-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKRHEMVVAK HSALCSRFAQ DLWLEQNIKD SFQKVTLSRY GKYGHKNLQL
60 70 80 90 100
RKGCKSVDEC KGHQGGFNGL NQCLKITTSK IFQCNKYVKV MHKFSNSNRH
110 120 130 140 150
KIRHTENKHF RCKECDKSLC MLSRLTQHKK IHTRENFYKC EECGKTFNWS
160 170 180 190 200
TNLSKPKKIH TGEKPYKCEV CGKAFHQSSI LTKHKIIRTG EKPYKCAHCG
210 220 230 240 250
KAFKQSSHLT RHKIIHTEEK PYKCEQCGKV FKQSPTLTKH QIIYTGEEPY
260
KCEECGKAFN LS
Length:262
Mass (Da):30,592
Last modified:July 10, 2007 - v2
Checksum:iD2B463F0E584ACE6
GO
Isoform 2 (identifier: P52744-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MKRHEMVVAKHS → MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFL

Note: No experimental confirmation available.Curated
Show »
Length:293
Mass (Da):34,333
Checksum:i75A81E4094BBDD30
GO
Isoform 3 (identifier: P52744-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MKRHEMVVAKHS → MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFL
     13-95: ALCSRFAQDL...KYVKVMHKFS → DLITCLEQGK...CVLVLPKTFG
     96-262: Missing.

Show »
Length:126
Mass (Da):14,597
Checksum:i0E5685E757EEEBBD
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti22 – 23LW → KG in AAC50263 (PubMed:7557990).Curated2
Sequence conflicti67F → Y in AK055644 (PubMed:14702039).Curated1
Sequence conflicti67F → Y in BAG60499 (PubMed:14702039).Curated1
Sequence conflicti67F → Y in AAC50263 (PubMed:7557990).Curated1
Isoform 2 (identifier: P52744-2)
Sequence conflicti33M → V in BAG60499 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05739862G → E2 PublicationsCorresponds to variant dbSNP:rs10949946Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0449211 – 12MKRHE…VAKHS → MGPLTFMDVAIEFSLEEWQC LDTAQRNVYRHVMLENYRNL VFL in isoform 2 and isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_04744613 – 95ALCSR…MHKFS → DLITCLEQGKEPWNMKRHEM VVAKHSAVAFTYDLSGLNIL SFQSILPFVSALYVMGNRNQ CLQKHLEARNKDLCVLVLPK TFG in isoform 3. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_04744796 – 262Missing in isoform 3. 1 PublicationAdd BLAST167

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055644 mRNA. No translation available.
AK294302 mRNA. Translation: BAG57583.1.
AK298230 mRNA. Translation: BAG60499.1.
AC073349 Genomic DNA. No translation available.
U09847 mRNA. Translation: AAC50263.1.
CCDSiCCDS34645.2. [P52744-2]
CCDS55115.1. [P52744-3]
PIRiI38615.
RefSeqiNP_001153655.1. NM_001160183.2.
NP_001258566.1. NM_001271637.1.
NP_006515.2. NM_006524.3.
UniGeneiHs.184080.

Genome annotation databases

EnsembliENST00000440155; ENSP00000407262; ENSG00000197008. [P52744-2]
GeneIDi7697.
KEGGihsa:7697.
UCSCiuc011kdq.4. human. [P52744-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiZN138_HUMAN
AccessioniPrimary (citable) accession number: P52744
Secondary accession number(s): B4DFX2
, B4DP87, E9PHI7, E9PHK7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: July 10, 2007
Last modified: August 30, 2017
This is version 144 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families