Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P52744 (ZN138_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 118. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 138
Gene names
Name:ZNF138
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length262 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May be involved in transcriptional regulation as a repressor.

Subcellular location

Nucleus Potential.

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 6 C2H2-type zinc fingers.

Ontologies

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P52744-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P52744-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MKRHEMVVAKHS → MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFL
Note: No experimental confirmation available.
Isoform 3 (identifier: P52744-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MKRHEMVVAKHS → MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFL
     13-95: ALCSRFAQDL...KYVKVMHKFS → DLITCLEQGK...CVLVLPKTFG
     96-262: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 262262Zinc finger protein 138
PRO_0000047422

Regions

Zinc finger110 – 13223C2H2-type 1
Zinc finger138 – 16023C2H2-type 2; degenerate
Zinc finger166 – 18823C2H2-type 3; degenerate
Zinc finger194 – 21623C2H2-type 4
Zinc finger222 – 24423C2H2-type 5; degenerate
Zinc finger250 – 26213C2H2-type 6; degenerate

Natural variations

Alternative sequence1 – 1212MKRHE…VAKHS → MGPLTFMDVAIEFSLEEWQC LDTAQRNVYRHVMLENYRNL VFL in isoform 2 and isoform 3.
VSP_044921
Alternative sequence13 – 9583ALCSR…MHKFS → DLITCLEQGKEPWNMKRHEM VVAKHSAVAFTYDLSGLNIL SFQSILPFVSALYVMGNRNQ CLQKHLEARNKDLCVLVLPK TFG in isoform 3.
VSP_047446
Alternative sequence96 – 262167Missing in isoform 3.
VSP_047447
Natural variant621G → E. Ref.1 Ref.3
Corresponds to variant rs10949946 [ dbSNP | Ensembl ].
VAR_057398

Experimental info

Sequence conflict22 – 232LW → KG in AAC50263. Ref.3
Sequence conflict671F → Y in AK055644. Ref.1
Sequence conflict671F → Y in BAG60499. Ref.1
Sequence conflict671F → Y in AAC50263. Ref.3
Isoform 2:
Sequence conflict331M → V in BAG60499. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 10, 2007. Version 2.
Checksum: D2B463F0E584ACE6

FASTA26230,592
        10         20         30         40         50         60 
MKRHEMVVAK HSALCSRFAQ DLWLEQNIKD SFQKVTLSRY GKYGHKNLQL RKGCKSVDEC 

        70         80         90        100        110        120 
KGHQGGFNGL NQCLKITTSK IFQCNKYVKV MHKFSNSNRH KIRHTENKHF RCKECDKSLC 

       130        140        150        160        170        180 
MLSRLTQHKK IHTRENFYKC EECGKTFNWS TNLSKPKKIH TGEKPYKCEV CGKAFHQSSI 

       190        200        210        220        230        240 
LTKHKIIRTG EKPYKCAHCG KAFKQSSHLT RHKIIHTEEK PYKCEQCGKV FKQSPTLTKH 

       250        260 
QIIYTGEEPY KCEECGKAFN LS 

« Hide

Isoform 2 [UniParc].

Checksum: 75A81E4094BBDD30
Show »

FASTA29334,333
Isoform 3 [UniParc].

Checksum: 0E5685E757EEEBBD
Show »

FASTA12614,597

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT GLU-62.
Tissue: Amygdala.
[2]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders."
Tommerup N., Vissing H.
Genomics 27:259-264(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 22-260 (ISOFORM 1), VARIANT GLU-62.
Tissue: Insulinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK055644 mRNA. No translation available.
AK294302 mRNA. Translation: BAG57583.1.
AK298230 mRNA. Translation: BAG60499.1.
AC073349 Genomic DNA. No translation available.
U09847 mRNA. Translation: AAC50263.1.
CCDSCCDS34645.2. [P52744-2]
CCDS55115.1. [P52744-3]
PIRI38615.
RefSeqNP_001153655.1. NM_001160183.2.
NP_001258566.1. NM_001271637.1.
NP_006515.2. NM_006524.3.
UniGeneHs.184080.

3D structure databases

ProteinModelPortalP52744.
SMRP52744. Positions 94-262.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteP52744.

Polymorphism databases

DMDM152031767.

Proteomic databases

PaxDbP52744.
PRIDEP52744.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000359735; ENSP00000352770; ENSG00000197008. [P52744-1]
ENST00000397136; ENSP00000380325; ENSG00000197008. [P52744-1]
ENST00000440155; ENSP00000407262; ENSG00000197008. [P52744-2]
GeneID7697.
KEGGhsa:7697.
UCSCuc003tth.4. human. [P52744-1]

Organism-specific databases

CTD7697.
GeneCardsGC07P064254.
HGNCHGNC:12922. ZNF138.
MIM604080. gene.
neXtProtNX_P52744.
PharmGKBPA37510.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOGENOMHOG000234617.
HOVERGENHBG018163.
InParanoidP52744.
PhylomeDBP52744.
TreeFamTF342117.

Enzyme and pathway databases

ReactomeREACT_71. Gene Expression.

Gene expression databases

ArrayExpressP52744.
BgeeP52744.
CleanExHS_ZNF138.
GenevestigatorP52744.

Family and domain databases

Gene3D3.30.160.60. 6 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 2 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi7697.
NextBio29838.
PROP52744.
SOURCESearch...

Entry information

Entry nameZN138_HUMAN
AccessionPrimary (citable) accession number: P52744
Secondary accession number(s): B4DFX2 expand/collapse secondary AC list , B4DP87, E9PHI7, E9PHK7
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: July 10, 2007
Last modified: July 9, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM