P52744 (ZN138_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger protein 138 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 262 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May be involved in transcriptional regulation as a repressor. |
| Subcellular location | Nucleus Potential. |
| Sequence similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. Contains 6 C2H2-type zinc fingers. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Molecular function | Repressor |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleus Non-traceable author statement Ref.3. Source: UniProtKB |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW sequence-specific DNA binding transcription factor activityNon-traceable author statement Ref.3. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P52744-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P52744-2) The sequence of this isoform differs from the canonical sequence as follows: 1-12: MKRHEMVVAKHS → MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 262 | 262 | Zinc finger protein 138 | PRO_0000047422 | |||||
Regions | |||||||||
| Zinc finger | 110 – 132 | 23 | C2H2-type 1 | ||||||
| Zinc finger | 138 – 160 | 23 | C2H2-type 2; degenerate | ||||||
| Zinc finger | 166 – 188 | 23 | C2H2-type 3; degenerate | ||||||
| Zinc finger | 194 – 216 | 23 | C2H2-type 4 | ||||||
| Zinc finger | 222 – 244 | 23 | C2H2-type 5; degenerate | ||||||
| Zinc finger | 250 – 262 | 13 | C2H2-type 6; degenerate | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 12 | 12 | MKRHE…VAKHS → MGPLTFMDVAIEFSLEEWQC LDTAQRNVYRHVMLENYRNL VFL in isoform 2. | VSP_044921 | |||||
| Natural variant | 62 | 1 | G → E. Ref.1 Ref.3 Corresponds to variant rs10949946 [ dbSNP | Ensembl ]. | VAR_057398 | |||||
Experimental info | |||||||||
| Sequence conflict | 22 – 23 | 2 | LW → KG in AAC50263. Ref.3 | ||||||
| Sequence conflict | 67 | 1 | F → Y in AK055644. Ref.1 | ||||||
| Sequence conflict | 67 | 1 | F → Y in BAG60499. Ref.1 | ||||||
| Sequence conflict | 67 | 1 | F → Y in AAC50263. Ref.3 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 33 | 1 | M → V in BAG60499. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK055644 mRNA. No translation available. AK298230 mRNA. Translation: BAG60499.1. AC073349 Genomic DNA. No translation available. U09847 mRNA. Translation: AAC50263.1. |
| IPI | IPI00377099. IPI00926871. |
| PIR | I38615. |
| RefSeq | NP_001153655.1. NM_001160183.2. NP_001258566.1. NM_001271637.1. NP_006515.2. NM_006524.3. |
| UniGene | Hs.184080. |
3D structure databases | |
| ProteinModelPortal | P52744. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P52744. |
Polymorphism databases | |
| DMDM | 152031767. |
Proteomic databases | |
| PaxDb | P52744. |
| PRIDE | P52744. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000359735; ENSP00000352770; ENSG00000197008. ENST00000397136; ENSP00000380325; ENSG00000197008. ENST00000440155; ENSP00000407262; ENSG00000197008. |
| GeneID | 7697. |
| KEGG | hsa:7697. |
| UCSC | uc003ttg.3. human. |
Organism-specific databases | |
| GeneCards | GC07P064254. |
| HGNC | HGNC:12922. ZNF138. |
| MIM | 604080. gene. |
| neXtProt | NX_P52744. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5048. |
| HOGENOM | HOG000234617. |
| HOVERGEN | HBG018163. |
| InParanoid | P52744. |
| PhylomeDB | P52744. |
Enzyme and pathway databases | |
| Reactome | REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | P52744. |
| Bgee | P52744. |
| CleanEx | HS_ZNF138. |
| Genevestigator | P52744. |
| GermOnline | ENSG00000197008. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.160.60. 6 hits. |
| InterPro | IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| SMART | SM00355. ZnF_C2H2. 5 hits. [Graphical view] |
| PROSITE | PS00028. ZINC_FINGER_C2H2_1. 2 hits. PS50157. ZINC_FINGER_C2H2_2. 6 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 29838. |
| SOURCE | Search... |
Entry information
| Entry name | ZN138_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P52744 Secondary accession number(s): B4DP87, E9PHI7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
