Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cationic amino acid transporter 2

Gene

SLC7A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine); the affinity for its substrates differs between isoforms created by alternative splicing. Isoform 1 functions as permease that mediates the transport of the cationic amino acids (arginine, lysine and ornithine), and it has much higher affinity for arginine than isoform 2. Isoform 2 functions as low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) (PubMed:9174363). May play a role in classical or alternative activation of macrophages via its role in arginine transport.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Amino-acid transport, Transport

Enzyme and pathway databases

ReactomeiREACT_13796. Amino acid transport across the plasma membrane.

Protein family/group databases

TCDBi2.A.3.3.8. the amino acid-polyamine-organocation (apc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Cationic amino acid transporter 2
Short name:
CAT-2
Short name:
CAT2
Alternative name(s):
Low affinity cationic amino acid transporter 2
Solute carrier family 7 member 2
Gene namesi
Name:SLC7A2
Synonyms:ATRC2, CAT2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:11060. SLC7A2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3737CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei38 – 5922HelicalSequence AnalysisAdd
BLAST
Topological domaini60 – 634ExtracellularSequence Analysis
Transmembranei64 – 8421HelicalSequence AnalysisAdd
BLAST
Topological domaini85 – 10420CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei105 – 12521HelicalSequence AnalysisAdd
BLAST
Topological domaini126 – 16338ExtracellularSequence AnalysisAdd
BLAST
Transmembranei164 – 18421HelicalSequence AnalysisAdd
BLAST
Topological domaini185 – 1928CytoplasmicSequence Analysis
Transmembranei193 – 21321HelicalSequence AnalysisAdd
BLAST
Topological domaini214 – 24835ExtracellularSequence AnalysisAdd
BLAST
Transmembranei249 – 26921HelicalSequence AnalysisAdd
BLAST
Topological domaini270 – 28920CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei290 – 30920HelicalSequence AnalysisAdd
BLAST
Topological domaini310 – 33930ExtracellularSequence AnalysisAdd
BLAST
Transmembranei340 – 36021HelicalSequence AnalysisAdd
BLAST
Topological domaini361 – 38626CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei387 – 40721HelicalSequence AnalysisAdd
BLAST
Topological domaini408 – 4103ExtracellularSequence Analysis
Transmembranei411 – 43121HelicalSequence AnalysisAdd
BLAST
Topological domaini432 – 49059CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei491 – 51121HelicalSequence AnalysisAdd
BLAST
Topological domaini512 – 52413ExtracellularSequence AnalysisAdd
BLAST
Transmembranei525 – 54925HelicalSequence AnalysisAdd
BLAST
Topological domaini550 – 5578CytoplasmicSequence Analysis
Transmembranei558 – 57821HelicalSequence AnalysisAdd
BLAST
Topological domaini579 – 5824ExtracellularSequence Analysis
Transmembranei583 – 60321HelicalSequence AnalysisAdd
BLAST
Topological domaini604 – 65855CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • membrane Source: ProtInc
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35920.

Chemistry

DrugBankiDB00123. L-Lysine.
DB00129. L-Ornithine.

Polymorphism and mutation databases

BioMutaiSLC7A2.
DMDMi126302539.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 658658Cationic amino acid transporter 2PRO_0000054264Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi157 – 1571N-linked (GlcNAc...)Sequence Analysis
Glycosylationi227 – 2271N-linked (GlcNAc...)Sequence Analysis
Glycosylationi239 – 2391N-linked (GlcNAc...)Sequence Analysis
Modified residuei455 – 4551Phosphoserine1 Publication
Modified residuei646 – 6461Phosphoserine2 Publications

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP52569.
PaxDbiP52569.
PRIDEiP52569.

PTM databases

PhosphoSiteiP52569.

Expressioni

Tissue specificityi

Expressed at high levels in the skeletal muscle, placenta and ovary. Expressed at intermediate levels in the liver and pancreas and at low levels in the kidney and heart.1 Publication

Gene expression databases

BgeeiP52569.
CleanExiHS_SLC7A2.
GenevisibleiP52569. HS.

Organism-specific databases

HPAiHPA009169.

Interactioni

Protein-protein interaction databases

BioGridi112433. 9 interactions.
IntActiP52569. 1 interaction.
STRINGi9606.ENSP00000004531.

Structurei

3D structure databases

ProteinModelPortaliP52569.
SMRiP52569. Positions 34-425.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0531.
GeneTreeiENSGT00760000119151.
HOGENOMiHOG000250623.
HOVERGENiHBG000280.
InParanoidiP52569.
KOiK13864.
OMAiTFGWYGL.
OrthoDBiEOG72C501.
PhylomeDBiP52569.
TreeFamiTF315212.

Family and domain databases

InterProiIPR002293. AA/rel_permease1.
IPR004755. Cat_AA_permease.
IPR029485. CAT_C.
[Graphical view]
PANTHERiPTHR11785. PTHR11785. 1 hit.
PfamiPF13520. AA_permease_2. 1 hit.
PF13906. AA_permease_C. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00906. 2A0303. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P52569-1) [UniParc]FASTAAdd to basket

Also known as: CAT-2B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIPCRAALTF ARCLIRRKIV TLDSLEDTKL CRCLSTMDLI ALGVGSTLGA
60 70 80 90 100
GVYVLAGEVA KADSGPSIVV SFLIAALASV MAGLCYAEFG ARVPKTGSAY
110 120 130 140 150
LYTYVTVGEL WAFITGWNLI LSYVIGTSSV ARAWSGTFDE LLSKQIGQFL
160 170 180 190 200
RTYFRMNYTG LAEYPDFFAV CLILLLAGLL SFGVKESAWV NKVFTAVNIL
210 220 230 240 250
VLLFVMVAGF VKGNVANWKI SEEFLKNISA SAREPPSENG TSIYGAGGFM
260 270 280 290 300
PYGFTGTLAG AATCFYAFVG FDCIATTGEE VRNPQKAIPI GIVTSLLVCF
310 320 330 340 350
MAYFGVSAAL TLMMPYYLLD EKSPLPVAFE YVGWGPAKYV VAAGSLCALS
360 370 380 390 400
TSLLGSIFPM PRVIYAMAED GLLFKCLAQI NSKTKTPIIA TLSSGAVAAL
410 420 430 440 450
MAFLFDLKAL VDMMSIGTLM AYSLVAACVL ILRYQPGLSY DQPKCSPEKD
460 470 480 490 500
GLGSSPRVTS KSESQVTMLQ RQGFSMRTLF CPSLLPTQQS ASLVSFLVGF
510 520 530 540 550
LAFLVLGLSV LTTYGVHAIT RLEAWSLALL ALFLVLFVAI VLTIWRQPQN
560 570 580 590 600
QQKVAFMVPF LPFLPAFSIL VNIYLMVQLS ADTWVRFSIW MAIGFLIYFS
610 620 630 640 650
YGIRHSLEGH LRDENNEEDA YPDNVHAAAE EKSAIQANDH HPRNLSSPFI

FHEKTSEF
Length:658
Mass (Da):71,673
Last modified:February 20, 2007 - v2
Checksum:i633FD86A333E9208
GO
Isoform 2 (identifier: P52569-2) [UniParc]FASTAAdd to basket

Also known as: CAT-2A

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPSSDVRM
     357-398: IFPMPRVIYA...IATLSSGAVA → MFPLPRILFA...AATLTAGVIS

Show »
Length:697
Mass (Da):76,024
Checksum:iA5753DDB8FF1FFFA
GO
Isoform 3 (identifier: P52569-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPSSDVRM

Note: No experimental confirmation available.
Show »
Length:698
Mass (Da):75,986
Checksum:i6ED2F36C607015C0
GO

Sequence cautioni

Isoform 2 : The sequence AAB62810.1 differs from that shown. Reason: Frameshift at position 29. Curated
The sequence AAH69648.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI04906.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI13662.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI43584.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti134 – 1341W → G in BAA06271 (PubMed:8954799).Curated
Sequence conflicti364 – 3641I → N in BAA06271 (PubMed:8954799).Curated
Sequence conflicti520 – 5201T → Y in BAA06271 (PubMed:8954799).Curated
Sequence conflicti552 – 5521Q → R in BAA06271 (PubMed:8954799).Curated
Sequence conflicti566 – 5661A → T in BAA06271 (PubMed:8954799).Curated
Sequence conflicti568 – 5681S → T in BAA06271 (PubMed:8954799).Curated
Sequence conflicti605 – 6051H → R in CAD89909 (PubMed:17974005).Curated
Sequence conflicti619 – 6191D → V in CAD89909 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti20 – 201V → M.
Corresponds to variant rs12680645 [ dbSNP | Ensembl ].
VAR_030799
Natural varianti376 – 3761C → F.
Corresponds to variant rs1134975 [ dbSNP | Ensembl ].
VAR_030800
Natural varianti531 – 5311A → T.2 Publications
Corresponds to variant rs62622371 [ dbSNP | Ensembl ].
VAR_030801
Natural varianti547 – 5471Q → L.
Corresponds to variant rs1981498 [ dbSNP | Ensembl ].
VAR_058414

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MKIETSGYNSDKLICRGFIG TPAPPVCDSKFLLSPSSDVR M in isoform 2 and isoform 3. 2 PublicationsVSP_037354
Alternative sequencei357 – 39842IFPMP…SGAVA → MFPLPRILFAMARDGLLFRF LARVSKRQSPVAATLTAGVI S in isoform 2. 2 PublicationsVSP_023354Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D29990 mRNA. Translation: BAA06271.1.
U76368 mRNA. Translation: AAB62810.1. Frameshift.
U76369 mRNA. Translation: AAB62811.1.
AB020863 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63813.1.
BC069648 mRNA. Translation: AAH69648.1. Different initiation.
BC104905 mRNA. Translation: AAI04906.1. Different initiation.
BC113661 mRNA. Translation: AAI13662.1. Different initiation.
BC143583 mRNA. Translation: AAI43584.1. Different initiation.
AL832016 mRNA. Translation: CAD89909.1.
CCDSiCCDS34852.1. [P52569-1]
CCDS55203.1. [P52569-3]
CCDS6002.2. [P52569-2]
RefSeqiNP_001008539.3. NM_001008539.3. [P52569-1]
NP_001158243.1. NM_001164771.1. [P52569-3]
NP_003037.4. NM_003046.5. [P52569-2]
XP_005273667.1. XM_005273610.3. [P52569-1]
XP_005273668.1. XM_005273611.3. [P52569-1]
XP_005273669.1. XM_005273612.3. [P52569-1]
UniGeneiHs.448520.

Genome annotation databases

EnsembliENST00000004531; ENSP00000004531; ENSG00000003989. [P52569-3]
ENST00000398090; ENSP00000381164; ENSG00000003989. [P52569-2]
ENST00000470360; ENSP00000419873; ENSG00000003989. [P52569-2]
ENST00000494857; ENSP00000419140; ENSG00000003989. [P52569-1]
ENST00000522656; ENSP00000430464; ENSG00000003989. [P52569-1]
GeneIDi6542.
KEGGihsa:6542.
UCSCiuc011kyc.2. human. [P52569-1]
uc011kyd.2. human. [P52569-2]
uc011kye.2. human. [P52569-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D29990 mRNA. Translation: BAA06271.1.
U76368 mRNA. Translation: AAB62810.1. Frameshift.
U76369 mRNA. Translation: AAB62811.1.
AB020863 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63813.1.
BC069648 mRNA. Translation: AAH69648.1. Different initiation.
BC104905 mRNA. Translation: AAI04906.1. Different initiation.
BC113661 mRNA. Translation: AAI13662.1. Different initiation.
BC143583 mRNA. Translation: AAI43584.1. Different initiation.
AL832016 mRNA. Translation: CAD89909.1.
CCDSiCCDS34852.1. [P52569-1]
CCDS55203.1. [P52569-3]
CCDS6002.2. [P52569-2]
RefSeqiNP_001008539.3. NM_001008539.3. [P52569-1]
NP_001158243.1. NM_001164771.1. [P52569-3]
NP_003037.4. NM_003046.5. [P52569-2]
XP_005273667.1. XM_005273610.3. [P52569-1]
XP_005273668.1. XM_005273611.3. [P52569-1]
XP_005273669.1. XM_005273612.3. [P52569-1]
UniGeneiHs.448520.

3D structure databases

ProteinModelPortaliP52569.
SMRiP52569. Positions 34-425.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112433. 9 interactions.
IntActiP52569. 1 interaction.
STRINGi9606.ENSP00000004531.

Chemistry

DrugBankiDB00123. L-Lysine.
DB00129. L-Ornithine.

Protein family/group databases

TCDBi2.A.3.3.8. the amino acid-polyamine-organocation (apc) family.

PTM databases

PhosphoSiteiP52569.

Polymorphism and mutation databases

BioMutaiSLC7A2.
DMDMi126302539.

Proteomic databases

MaxQBiP52569.
PaxDbiP52569.
PRIDEiP52569.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000004531; ENSP00000004531; ENSG00000003989. [P52569-3]
ENST00000398090; ENSP00000381164; ENSG00000003989. [P52569-2]
ENST00000470360; ENSP00000419873; ENSG00000003989. [P52569-2]
ENST00000494857; ENSP00000419140; ENSG00000003989. [P52569-1]
ENST00000522656; ENSP00000430464; ENSG00000003989. [P52569-1]
GeneIDi6542.
KEGGihsa:6542.
UCSCiuc011kyc.2. human. [P52569-1]
uc011kyd.2. human. [P52569-2]
uc011kye.2. human. [P52569-3]

Organism-specific databases

CTDi6542.
GeneCardsiGC08P017354.
HGNCiHGNC:11060. SLC7A2.
HPAiHPA009169.
MIMi601872. gene.
neXtProtiNX_P52569.
PharmGKBiPA35920.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0531.
GeneTreeiENSGT00760000119151.
HOGENOMiHOG000250623.
HOVERGENiHBG000280.
InParanoidiP52569.
KOiK13864.
OMAiTFGWYGL.
OrthoDBiEOG72C501.
PhylomeDBiP52569.
TreeFamiTF315212.

Enzyme and pathway databases

ReactomeiREACT_13796. Amino acid transport across the plasma membrane.

Miscellaneous databases

ChiTaRSiSLC7A2. human.
GeneWikiiSLC7A2.
GenomeRNAii6542.
NextBioi25455.
PROiP52569.
SOURCEiSearch...

Gene expression databases

BgeeiP52569.
CleanExiHS_SLC7A2.
GenevisibleiP52569. HS.

Family and domain databases

InterProiIPR002293. AA/rel_permease1.
IPR004755. Cat_AA_permease.
IPR029485. CAT_C.
[Graphical view]
PANTHERiPTHR11785. PTHR11785. 1 hit.
PfamiPF13520. AA_permease_2. 1 hit.
PF13906. AA_permease_C. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00906. 2A0303. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning, tissue distribution, and chromosomal localization of human cationic amino acid transporter 2 (HCAT2)."
    Hoshide R., Ikeda Y., Karashima S., Matsuura T., Komaki S., Kishino T., Niikawa N., Endo F., Matsuda I.
    Genomics 38:174-178(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Intestine.
  2. "Human cationic amino acid transporters hCAT-1, hCAT-2A, and hCAT-2B: three related carriers with distinct transport properties."
    Closs E.I., Graef P., Habermeier A., Cunningham J.M., Foerstermann U.
    Biochemistry 36:6462-6468(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [MRNA] OF 337-469 (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, VARIANT THR-531.
    Tissue: Liver.
  3. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT THR-531.
    Tissue: Liver.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-658 (ISOFORM 2).
    Tissue: Skeletal muscle.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-646, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-455, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-646, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiCTR2_HUMAN
AccessioniPrimary (citable) accession number: P52569
Secondary accession number(s): B7ZL54
, O15291, O15292, Q14CQ6, Q6NSZ7, Q86TC6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: February 20, 2007
Last modified: June 24, 2015
This is version 137 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.