SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P52569

- CTR2_HUMAN

UniProt

P52569 - CTR2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Low affinity cationic amino acid transporter 2
Gene
SLC7A2, ATRC2, CAT2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages By similarity.1 Publication

GO - Molecular functioni

  1. L-lysine transmembrane transporter activity Source: Ensembl
  2. L-ornithine transmembrane transporter activity Source: Ensembl
  3. basic amino acid transmembrane transporter activity Source: ProtInc
  4. high affinity arginine transmembrane transporter activity Source: Ensembl

GO - Biological processi

  1. amino acid transport Source: Reactome
  2. cellular amino acid metabolic process Source: ProtInc
  3. ion transport Source: Reactome
  4. macrophage activation Source: Ensembl
  5. nitric oxide biosynthetic process Source: Ensembl
  6. nitric oxide production involved in inflammatory response Source: Ensembl
  7. regulation of inflammatory response Source: Ensembl
  8. regulation of macrophage activation Source: Ensembl
  9. transmembrane transport Source: Reactome
  10. transport Source: ProtInc
Complete GO annotation...

Keywords - Biological processi

Amino-acid transport, Transport

Enzyme and pathway databases

ReactomeiREACT_13796. Amino acid transport across the plasma membrane.

Protein family/group databases

TCDBi2.A.3.3.8. the amino acid-polyamine-organocation (apc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Low affinity cationic amino acid transporter 2
Short name:
CAT-2
Short name:
CAT2
Alternative name(s):
Solute carrier family 7 member 2
Gene namesi
Name:SLC7A2
Synonyms:ATRC2, CAT2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:11060. SLC7A2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3737Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei38 – 5922Helical; Reviewed prediction
Add
BLAST
Topological domaini60 – 634Extracellular Reviewed prediction
Transmembranei64 – 8421Helical; Reviewed prediction
Add
BLAST
Topological domaini85 – 10420Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei105 – 12521Helical; Reviewed prediction
Add
BLAST
Topological domaini126 – 16338Extracellular Reviewed prediction
Add
BLAST
Transmembranei164 – 18421Helical; Reviewed prediction
Add
BLAST
Topological domaini185 – 1928Cytoplasmic Reviewed prediction
Transmembranei193 – 21321Helical; Reviewed prediction
Add
BLAST
Topological domaini214 – 24835Extracellular Reviewed prediction
Add
BLAST
Transmembranei249 – 26921Helical; Reviewed prediction
Add
BLAST
Topological domaini270 – 28920Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei290 – 30920Helical; Reviewed prediction
Add
BLAST
Topological domaini310 – 33930Extracellular Reviewed prediction
Add
BLAST
Transmembranei340 – 36021Helical; Reviewed prediction
Add
BLAST
Topological domaini361 – 38626Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei387 – 40721Helical; Reviewed prediction
Add
BLAST
Topological domaini408 – 4103Extracellular Reviewed prediction
Transmembranei411 – 43121Helical; Reviewed prediction
Add
BLAST
Topological domaini432 – 49059Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei491 – 51121Helical; Reviewed prediction
Add
BLAST
Topological domaini512 – 52413Extracellular Reviewed prediction
Add
BLAST
Transmembranei525 – 54925Helical; Reviewed prediction
Add
BLAST
Topological domaini550 – 5578Cytoplasmic Reviewed prediction
Transmembranei558 – 57821Helical; Reviewed prediction
Add
BLAST
Topological domaini579 – 5824Extracellular Reviewed prediction
Transmembranei583 – 60321Helical; Reviewed prediction
Add
BLAST
Topological domaini604 – 65855Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. membrane Source: ProtInc
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35920.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 658658Low affinity cationic amino acid transporter 2
PRO_0000054264Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi157 – 1571N-linked (GlcNAc...) Reviewed prediction
Glycosylationi227 – 2271N-linked (GlcNAc...) Reviewed prediction
Glycosylationi239 – 2391N-linked (GlcNAc...) Reviewed prediction
Modified residuei455 – 4551Phosphoserine1 Publication
Modified residuei646 – 6461Phosphoserine1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP52569.
PaxDbiP52569.
PRIDEiP52569.

PTM databases

PhosphoSiteiP52569.

Expressioni

Tissue specificityi

Expressed at high levels in the skeletal muscle, placenta and ovary. Expressed at intermediate levels in the liver and pancreas and at low levels in the kidney and heart.1 Publication

Gene expression databases

BgeeiP52569.
CleanExiHS_SLC7A2.
GenevestigatoriP52569.

Organism-specific databases

HPAiHPA009169.

Interactioni

Protein-protein interaction databases

BioGridi112433. 1 interaction.
IntActiP52569. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliP52569.
SMRiP52569. Positions 34-425.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0531.
HOGENOMiHOG000250623.
HOVERGENiHBG000280.
KOiK13864.
OMAiVPYVNTW.
OrthoDBiEOG72C501.
PhylomeDBiP52569.
TreeFamiTF315212.

Family and domain databases

InterProiIPR002293. AA/rel_permease1.
IPR004755. Cat_AA_permease.
IPR029485. CAT_C.
[Graphical view]
PANTHERiPTHR11785. PTHR11785. 1 hit.
PfamiPF13520. AA_permease_2. 1 hit.
PF13906. AA_permease_C. 1 hit.
[Graphical view]
PIRSFiPIRSF006060. AA_transporter. 1 hit.
TIGRFAMsiTIGR00906. 2A0303. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P52569-1) [UniParc]FASTAAdd to Basket

Also known as: CAT-2B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MIPCRAALTF ARCLIRRKIV TLDSLEDTKL CRCLSTMDLI ALGVGSTLGA    50
GVYVLAGEVA KADSGPSIVV SFLIAALASV MAGLCYAEFG ARVPKTGSAY 100
LYTYVTVGEL WAFITGWNLI LSYVIGTSSV ARAWSGTFDE LLSKQIGQFL 150
RTYFRMNYTG LAEYPDFFAV CLILLLAGLL SFGVKESAWV NKVFTAVNIL 200
VLLFVMVAGF VKGNVANWKI SEEFLKNISA SAREPPSENG TSIYGAGGFM 250
PYGFTGTLAG AATCFYAFVG FDCIATTGEE VRNPQKAIPI GIVTSLLVCF 300
MAYFGVSAAL TLMMPYYLLD EKSPLPVAFE YVGWGPAKYV VAAGSLCALS 350
TSLLGSIFPM PRVIYAMAED GLLFKCLAQI NSKTKTPIIA TLSSGAVAAL 400
MAFLFDLKAL VDMMSIGTLM AYSLVAACVL ILRYQPGLSY DQPKCSPEKD 450
GLGSSPRVTS KSESQVTMLQ RQGFSMRTLF CPSLLPTQQS ASLVSFLVGF 500
LAFLVLGLSV LTTYGVHAIT RLEAWSLALL ALFLVLFVAI VLTIWRQPQN 550
QQKVAFMVPF LPFLPAFSIL VNIYLMVQLS ADTWVRFSIW MAIGFLIYFS 600
YGIRHSLEGH LRDENNEEDA YPDNVHAAAE EKSAIQANDH HPRNLSSPFI 650
FHEKTSEF 658
Length:658
Mass (Da):71,673
Last modified:February 20, 2007 - v2
Checksum:i633FD86A333E9208
GO
Isoform 2 (identifier: P52569-2) [UniParc]FASTAAdd to Basket

Also known as: CAT-2A

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPSSDVRM
     357-398: IFPMPRVIYA...IATLSSGAVA → MFPLPRILFA...AATLTAGVIS

Show »
Length:697
Mass (Da):76,024
Checksum:iA5753DDB8FF1FFFA
GO
Isoform 3 (identifier: P52569-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPSSDVRM

Note: No experimental confirmation available.

Show »
Length:698
Mass (Da):75,986
Checksum:i6ED2F36C607015C0
GO

Sequence cautioni

Isoform 2 : The sequence AAB62810.1 differs from that shown. Reason: Frameshift at position 29.
The sequence AAH69648.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence AAI04906.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence AAI13662.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence AAI43584.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti20 – 201V → M.
Corresponds to variant rs12680645 [ dbSNP | Ensembl ].
VAR_030799
Natural varianti376 – 3761C → F.
Corresponds to variant rs1134975 [ dbSNP | Ensembl ].
VAR_030800
Natural varianti531 – 5311A → T.2 Publications
Corresponds to variant rs62622371 [ dbSNP | Ensembl ].
VAR_030801
Natural varianti547 – 5471Q → L.
Corresponds to variant rs1981498 [ dbSNP | Ensembl ].
VAR_058414

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MKIETSGYNSDKLICRGFIG TPAPPVCDSKFLLSPSSDVR M in isoform 2 and isoform 3.
VSP_037354
Alternative sequencei357 – 39842IFPMP…SGAVA → MFPLPRILFAMARDGLLFRF LARVSKRQSPVAATLTAGVI S in isoform 2.
VSP_023354Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti134 – 1341W → G in BAA06271. 1 Publication
Sequence conflicti364 – 3641I → N in BAA06271. 1 Publication
Sequence conflicti520 – 5201T → Y in BAA06271. 1 Publication
Sequence conflicti552 – 5521Q → R in BAA06271. 1 Publication
Sequence conflicti566 – 5661A → T in BAA06271. 1 Publication
Sequence conflicti568 – 5681S → T in BAA06271. 1 Publication
Sequence conflicti605 – 6051H → R in CAD89909. 1 Publication
Sequence conflicti619 – 6191D → V in CAD89909. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D29990 mRNA. Translation: BAA06271.1.
U76368 mRNA. Translation: AAB62810.1. Frameshift.
U76369 mRNA. Translation: AAB62811.1.
AB020863 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63813.1.
BC069648 mRNA. Translation: AAH69648.1. Different initiation.
BC104905 mRNA. Translation: AAI04906.1. Different initiation.
BC113661 mRNA. Translation: AAI13662.1. Different initiation.
BC143583 mRNA. Translation: AAI43584.1. Different initiation.
AL832016 mRNA. Translation: CAD89909.1.
CCDSiCCDS34852.1. [P52569-1]
CCDS55203.1. [P52569-3]
CCDS6002.2. [P52569-2]
RefSeqiNP_001008539.3. NM_001008539.3. [P52569-1]
NP_001158243.1. NM_001164771.1. [P52569-3]
NP_003037.4. NM_003046.5. [P52569-2]
XP_005273667.1. XM_005273610.2. [P52569-1]
XP_005273668.1. XM_005273611.2. [P52569-1]
XP_005273669.1. XM_005273612.2. [P52569-1]
UniGeneiHs.448520.

Genome annotation databases

EnsembliENST00000004531; ENSP00000004531; ENSG00000003989. [P52569-3]
ENST00000398090; ENSP00000381164; ENSG00000003989. [P52569-2]
ENST00000470360; ENSP00000419873; ENSG00000003989. [P52569-2]
ENST00000494857; ENSP00000419140; ENSG00000003989. [P52569-1]
ENST00000522656; ENSP00000430464; ENSG00000003989. [P52569-1]
GeneIDi6542.
KEGGihsa:6542.
UCSCiuc011kyc.2. human. [P52569-1]
uc011kyd.2. human. [P52569-2]
uc011kye.2. human. [P52569-3]

Polymorphism databases

DMDMi126302539.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D29990 mRNA. Translation: BAA06271.1 .
U76368 mRNA. Translation: AAB62810.1 . Frameshift.
U76369 mRNA. Translation: AAB62811.1 .
AB020863 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63813.1 .
BC069648 mRNA. Translation: AAH69648.1 . Different initiation.
BC104905 mRNA. Translation: AAI04906.1 . Different initiation.
BC113661 mRNA. Translation: AAI13662.1 . Different initiation.
BC143583 mRNA. Translation: AAI43584.1 . Different initiation.
AL832016 mRNA. Translation: CAD89909.1 .
CCDSi CCDS34852.1. [P52569-1 ]
CCDS55203.1. [P52569-3 ]
CCDS6002.2. [P52569-2 ]
RefSeqi NP_001008539.3. NM_001008539.3. [P52569-1 ]
NP_001158243.1. NM_001164771.1. [P52569-3 ]
NP_003037.4. NM_003046.5. [P52569-2 ]
XP_005273667.1. XM_005273610.2. [P52569-1 ]
XP_005273668.1. XM_005273611.2. [P52569-1 ]
XP_005273669.1. XM_005273612.2. [P52569-1 ]
UniGenei Hs.448520.

3D structure databases

ProteinModelPortali P52569.
SMRi P52569. Positions 34-425.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112433. 1 interaction.
IntActi P52569. 1 interaction.

Chemistry

DrugBanki DB00123. L-Lysine.
DB00129. L-Ornithine.

Protein family/group databases

TCDBi 2.A.3.3.8. the amino acid-polyamine-organocation (apc) family.

PTM databases

PhosphoSitei P52569.

Polymorphism databases

DMDMi 126302539.

Proteomic databases

MaxQBi P52569.
PaxDbi P52569.
PRIDEi P52569.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000004531 ; ENSP00000004531 ; ENSG00000003989 . [P52569-3 ]
ENST00000398090 ; ENSP00000381164 ; ENSG00000003989 . [P52569-2 ]
ENST00000470360 ; ENSP00000419873 ; ENSG00000003989 . [P52569-2 ]
ENST00000494857 ; ENSP00000419140 ; ENSG00000003989 . [P52569-1 ]
ENST00000522656 ; ENSP00000430464 ; ENSG00000003989 . [P52569-1 ]
GeneIDi 6542.
KEGGi hsa:6542.
UCSCi uc011kyc.2. human. [P52569-1 ]
uc011kyd.2. human. [P52569-2 ]
uc011kye.2. human. [P52569-3 ]

Organism-specific databases

CTDi 6542.
GeneCardsi GC08P017354.
HGNCi HGNC:11060. SLC7A2.
HPAi HPA009169.
MIMi 601872. gene.
neXtProti NX_P52569.
PharmGKBi PA35920.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0531.
HOGENOMi HOG000250623.
HOVERGENi HBG000280.
KOi K13864.
OMAi VPYVNTW.
OrthoDBi EOG72C501.
PhylomeDBi P52569.
TreeFami TF315212.

Enzyme and pathway databases

Reactomei REACT_13796. Amino acid transport across the plasma membrane.

Miscellaneous databases

ChiTaRSi SLC7A2. human.
GeneWikii SLC7A2.
GenomeRNAii 6542.
NextBioi 25455.
PROi P52569.
SOURCEi Search...

Gene expression databases

Bgeei P52569.
CleanExi HS_SLC7A2.
Genevestigatori P52569.

Family and domain databases

InterProi IPR002293. AA/rel_permease1.
IPR004755. Cat_AA_permease.
IPR029485. CAT_C.
[Graphical view ]
PANTHERi PTHR11785. PTHR11785. 1 hit.
Pfami PF13520. AA_permease_2. 1 hit.
PF13906. AA_permease_C. 1 hit.
[Graphical view ]
PIRSFi PIRSF006060. AA_transporter. 1 hit.
TIGRFAMsi TIGR00906. 2A0303. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning, tissue distribution, and chromosomal localization of human cationic amino acid transporter 2 (HCAT2)."
    Hoshide R., Ikeda Y., Karashima S., Matsuura T., Komaki S., Kishino T., Niikawa N., Endo F., Matsuda I.
    Genomics 38:174-178(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Intestine.
  2. "Human cationic amino acid transporters hCAT-1, hCAT-2A, and hCAT-2B: three related carriers with distinct transport properties."
    Closs E.I., Graef P., Habermeier A., Cunningham J.M., Foerstermann U.
    Biochemistry 36:6462-6468(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [MRNA] OF 337-469 (ISOFORM 1), FUNCTION, VARIANT THR-531.
    Tissue: Liver.
  3. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT THR-531.
    Tissue: Liver.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-658 (ISOFORM 2).
    Tissue: Skeletal muscle.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-646, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-455, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiCTR2_HUMAN
AccessioniPrimary (citable) accession number: P52569
Secondary accession number(s): B7ZL54
, O15291, O15292, Q14CQ6, Q6NSZ7, Q86TC6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: February 20, 2007
Last modified: September 3, 2014
This is version 130 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi