Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P52569

- CTR2_HUMAN

UniProt

P52569 - CTR2_HUMAN

Protein

Low affinity cationic amino acid transporter 2

Gene

SLC7A2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 131 (01 Oct 2014)
      Sequence version 2 (20 Feb 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages By similarity.By similarity

    GO - Molecular functioni

    1. basic amino acid transmembrane transporter activity Source: ProtInc
    2. high-affinity arginine transmembrane transporter activity Source: Ensembl
    3. L-lysine transmembrane transporter activity Source: Ensembl
    4. L-ornithine transmembrane transporter activity Source: Ensembl

    GO - Biological processi

    1. amino acid transport Source: Reactome
    2. cellular amino acid metabolic process Source: ProtInc
    3. ion transport Source: Reactome
    4. macrophage activation Source: Ensembl
    5. nitric oxide biosynthetic process Source: Ensembl
    6. nitric oxide production involved in inflammatory response Source: Ensembl
    7. regulation of inflammatory response Source: Ensembl
    8. regulation of macrophage activation Source: Ensembl
    9. transmembrane transport Source: Reactome
    10. transport Source: ProtInc

    Keywords - Biological processi

    Amino-acid transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_13796. Amino acid transport across the plasma membrane.

    Protein family/group databases

    TCDBi2.A.3.3.8. the amino acid-polyamine-organocation (apc) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Low affinity cationic amino acid transporter 2
    Short name:
    CAT-2
    Short name:
    CAT2
    Alternative name(s):
    Solute carrier family 7 member 2
    Gene namesi
    Name:SLC7A2
    Synonyms:ATRC2, CAT2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:11060. SLC7A2.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. membrane Source: ProtInc
    3. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA35920.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 658658Low affinity cationic amino acid transporter 2PRO_0000054264Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi157 – 1571N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi227 – 2271N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi239 – 2391N-linked (GlcNAc...)Sequence Analysis
    Modified residuei455 – 4551Phosphoserine1 Publication
    Modified residuei646 – 6461Phosphoserine1 Publication

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiP52569.
    PaxDbiP52569.
    PRIDEiP52569.

    PTM databases

    PhosphoSiteiP52569.

    Expressioni

    Tissue specificityi

    Expressed at high levels in the skeletal muscle, placenta and ovary. Expressed at intermediate levels in the liver and pancreas and at low levels in the kidney and heart.1 Publication

    Gene expression databases

    BgeeiP52569.
    CleanExiHS_SLC7A2.
    GenevestigatoriP52569.

    Organism-specific databases

    HPAiHPA009169.

    Interactioni

    Protein-protein interaction databases

    BioGridi112433. 1 interaction.
    IntActiP52569. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliP52569.
    SMRiP52569. Positions 34-425.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3737CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini60 – 634ExtracellularSequence Analysis
    Topological domaini85 – 10420CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini126 – 16338ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini185 – 1928CytoplasmicSequence Analysis
    Topological domaini214 – 24835ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini270 – 28920CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini310 – 33930ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini361 – 38626CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini408 – 4103ExtracellularSequence Analysis
    Topological domaini432 – 49059CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini512 – 52413ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini550 – 5578CytoplasmicSequence Analysis
    Topological domaini579 – 5824ExtracellularSequence Analysis
    Topological domaini604 – 65855CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei38 – 5922HelicalSequence AnalysisAdd
    BLAST
    Transmembranei64 – 8421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei105 – 12521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei164 – 18421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei193 – 21321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei249 – 26921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei290 – 30920HelicalSequence AnalysisAdd
    BLAST
    Transmembranei340 – 36021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei387 – 40721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei411 – 43121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei491 – 51121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei525 – 54925HelicalSequence AnalysisAdd
    BLAST
    Transmembranei558 – 57821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei583 – 60321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0531.
    HOGENOMiHOG000250623.
    HOVERGENiHBG000280.
    KOiK13864.
    OMAiVPYVNTW.
    OrthoDBiEOG72C501.
    PhylomeDBiP52569.
    TreeFamiTF315212.

    Family and domain databases

    InterProiIPR002293. AA/rel_permease1.
    IPR004755. Cat_AA_permease.
    IPR029485. CAT_C.
    [Graphical view]
    PANTHERiPTHR11785. PTHR11785. 1 hit.
    PfamiPF13520. AA_permease_2. 1 hit.
    PF13906. AA_permease_C. 1 hit.
    [Graphical view]
    PIRSFiPIRSF006060. AA_transporter. 1 hit.
    TIGRFAMsiTIGR00906. 2A0303. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P52569-1) [UniParc]FASTAAdd to Basket

    Also known as: CAT-2B

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIPCRAALTF ARCLIRRKIV TLDSLEDTKL CRCLSTMDLI ALGVGSTLGA    50
    GVYVLAGEVA KADSGPSIVV SFLIAALASV MAGLCYAEFG ARVPKTGSAY 100
    LYTYVTVGEL WAFITGWNLI LSYVIGTSSV ARAWSGTFDE LLSKQIGQFL 150
    RTYFRMNYTG LAEYPDFFAV CLILLLAGLL SFGVKESAWV NKVFTAVNIL 200
    VLLFVMVAGF VKGNVANWKI SEEFLKNISA SAREPPSENG TSIYGAGGFM 250
    PYGFTGTLAG AATCFYAFVG FDCIATTGEE VRNPQKAIPI GIVTSLLVCF 300
    MAYFGVSAAL TLMMPYYLLD EKSPLPVAFE YVGWGPAKYV VAAGSLCALS 350
    TSLLGSIFPM PRVIYAMAED GLLFKCLAQI NSKTKTPIIA TLSSGAVAAL 400
    MAFLFDLKAL VDMMSIGTLM AYSLVAACVL ILRYQPGLSY DQPKCSPEKD 450
    GLGSSPRVTS KSESQVTMLQ RQGFSMRTLF CPSLLPTQQS ASLVSFLVGF 500
    LAFLVLGLSV LTTYGVHAIT RLEAWSLALL ALFLVLFVAI VLTIWRQPQN 550
    QQKVAFMVPF LPFLPAFSIL VNIYLMVQLS ADTWVRFSIW MAIGFLIYFS 600
    YGIRHSLEGH LRDENNEEDA YPDNVHAAAE EKSAIQANDH HPRNLSSPFI 650
    FHEKTSEF 658
    Length:658
    Mass (Da):71,673
    Last modified:February 20, 2007 - v2
    Checksum:i633FD86A333E9208
    GO
    Isoform 2 (identifier: P52569-2) [UniParc]FASTAAdd to Basket

    Also known as: CAT-2A

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPSSDVRM
         357-398: IFPMPRVIYA...IATLSSGAVA → MFPLPRILFA...AATLTAGVIS

    Show »
    Length:697
    Mass (Da):76,024
    Checksum:iA5753DDB8FF1FFFA
    GO
    Isoform 3 (identifier: P52569-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPSSDVRM

    Note: No experimental confirmation available.

    Show »
    Length:698
    Mass (Da):75,986
    Checksum:i6ED2F36C607015C0
    GO

    Sequence cautioni

    Isoform 2 : The sequence AAB62810.1 differs from that shown. Reason: Frameshift at position 29.
    The sequence AAH69648.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAI04906.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAI13662.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAI43584.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti134 – 1341W → G in BAA06271. (PubMed:8954799)Curated
    Sequence conflicti364 – 3641I → N in BAA06271. (PubMed:8954799)Curated
    Sequence conflicti520 – 5201T → Y in BAA06271. (PubMed:8954799)Curated
    Sequence conflicti552 – 5521Q → R in BAA06271. (PubMed:8954799)Curated
    Sequence conflicti566 – 5661A → T in BAA06271. (PubMed:8954799)Curated
    Sequence conflicti568 – 5681S → T in BAA06271. (PubMed:8954799)Curated
    Sequence conflicti605 – 6051H → R in CAD89909. (PubMed:17974005)Curated
    Sequence conflicti619 – 6191D → V in CAD89909. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti20 – 201V → M.
    Corresponds to variant rs12680645 [ dbSNP | Ensembl ].
    VAR_030799
    Natural varianti376 – 3761C → F.
    Corresponds to variant rs1134975 [ dbSNP | Ensembl ].
    VAR_030800
    Natural varianti531 – 5311A → T.2 Publications
    Corresponds to variant rs62622371 [ dbSNP | Ensembl ].
    VAR_030801
    Natural varianti547 – 5471Q → L.
    Corresponds to variant rs1981498 [ dbSNP | Ensembl ].
    VAR_058414

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MKIETSGYNSDKLICRGFIG TPAPPVCDSKFLLSPSSDVR M in isoform 2 and isoform 3. 2 PublicationsVSP_037354
    Alternative sequencei357 – 39842IFPMP…SGAVA → MFPLPRILFAMARDGLLFRF LARVSKRQSPVAATLTAGVI S in isoform 2. 2 PublicationsVSP_023354Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D29990 mRNA. Translation: BAA06271.1.
    U76368 mRNA. Translation: AAB62810.1. Frameshift.
    U76369 mRNA. Translation: AAB62811.1.
    AB020863 Genomic DNA. No translation available.
    CH471080 Genomic DNA. Translation: EAW63813.1.
    BC069648 mRNA. Translation: AAH69648.1. Different initiation.
    BC104905 mRNA. Translation: AAI04906.1. Different initiation.
    BC113661 mRNA. Translation: AAI13662.1. Different initiation.
    BC143583 mRNA. Translation: AAI43584.1. Different initiation.
    AL832016 mRNA. Translation: CAD89909.1.
    CCDSiCCDS34852.1. [P52569-1]
    CCDS55203.1. [P52569-3]
    CCDS6002.2. [P52569-2]
    RefSeqiNP_001008539.3. NM_001008539.3. [P52569-1]
    NP_001158243.1. NM_001164771.1. [P52569-3]
    NP_003037.4. NM_003046.5. [P52569-2]
    XP_005273667.1. XM_005273610.2. [P52569-1]
    XP_005273668.1. XM_005273611.2. [P52569-1]
    XP_005273669.1. XM_005273612.2. [P52569-1]
    UniGeneiHs.448520.

    Genome annotation databases

    EnsembliENST00000004531; ENSP00000004531; ENSG00000003989. [P52569-3]
    ENST00000398090; ENSP00000381164; ENSG00000003989. [P52569-2]
    ENST00000470360; ENSP00000419873; ENSG00000003989. [P52569-2]
    ENST00000494857; ENSP00000419140; ENSG00000003989. [P52569-1]
    ENST00000522656; ENSP00000430464; ENSG00000003989. [P52569-1]
    GeneIDi6542.
    KEGGihsa:6542.
    UCSCiuc011kyc.2. human. [P52569-1]
    uc011kyd.2. human. [P52569-2]
    uc011kye.2. human. [P52569-3]

    Polymorphism databases

    DMDMi126302539.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D29990 mRNA. Translation: BAA06271.1 .
    U76368 mRNA. Translation: AAB62810.1 . Frameshift.
    U76369 mRNA. Translation: AAB62811.1 .
    AB020863 Genomic DNA. No translation available.
    CH471080 Genomic DNA. Translation: EAW63813.1 .
    BC069648 mRNA. Translation: AAH69648.1 . Different initiation.
    BC104905 mRNA. Translation: AAI04906.1 . Different initiation.
    BC113661 mRNA. Translation: AAI13662.1 . Different initiation.
    BC143583 mRNA. Translation: AAI43584.1 . Different initiation.
    AL832016 mRNA. Translation: CAD89909.1 .
    CCDSi CCDS34852.1. [P52569-1 ]
    CCDS55203.1. [P52569-3 ]
    CCDS6002.2. [P52569-2 ]
    RefSeqi NP_001008539.3. NM_001008539.3. [P52569-1 ]
    NP_001158243.1. NM_001164771.1. [P52569-3 ]
    NP_003037.4. NM_003046.5. [P52569-2 ]
    XP_005273667.1. XM_005273610.2. [P52569-1 ]
    XP_005273668.1. XM_005273611.2. [P52569-1 ]
    XP_005273669.1. XM_005273612.2. [P52569-1 ]
    UniGenei Hs.448520.

    3D structure databases

    ProteinModelPortali P52569.
    SMRi P52569. Positions 34-425.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112433. 1 interaction.
    IntActi P52569. 1 interaction.

    Chemistry

    DrugBanki DB00123. L-Lysine.
    DB00129. L-Ornithine.

    Protein family/group databases

    TCDBi 2.A.3.3.8. the amino acid-polyamine-organocation (apc) family.

    PTM databases

    PhosphoSitei P52569.

    Polymorphism databases

    DMDMi 126302539.

    Proteomic databases

    MaxQBi P52569.
    PaxDbi P52569.
    PRIDEi P52569.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000004531 ; ENSP00000004531 ; ENSG00000003989 . [P52569-3 ]
    ENST00000398090 ; ENSP00000381164 ; ENSG00000003989 . [P52569-2 ]
    ENST00000470360 ; ENSP00000419873 ; ENSG00000003989 . [P52569-2 ]
    ENST00000494857 ; ENSP00000419140 ; ENSG00000003989 . [P52569-1 ]
    ENST00000522656 ; ENSP00000430464 ; ENSG00000003989 . [P52569-1 ]
    GeneIDi 6542.
    KEGGi hsa:6542.
    UCSCi uc011kyc.2. human. [P52569-1 ]
    uc011kyd.2. human. [P52569-2 ]
    uc011kye.2. human. [P52569-3 ]

    Organism-specific databases

    CTDi 6542.
    GeneCardsi GC08P017354.
    HGNCi HGNC:11060. SLC7A2.
    HPAi HPA009169.
    MIMi 601872. gene.
    neXtProti NX_P52569.
    PharmGKBi PA35920.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0531.
    HOGENOMi HOG000250623.
    HOVERGENi HBG000280.
    KOi K13864.
    OMAi VPYVNTW.
    OrthoDBi EOG72C501.
    PhylomeDBi P52569.
    TreeFami TF315212.

    Enzyme and pathway databases

    Reactomei REACT_13796. Amino acid transport across the plasma membrane.

    Miscellaneous databases

    ChiTaRSi SLC7A2. human.
    GeneWikii SLC7A2.
    GenomeRNAii 6542.
    NextBioi 25455.
    PROi P52569.
    SOURCEi Search...

    Gene expression databases

    Bgeei P52569.
    CleanExi HS_SLC7A2.
    Genevestigatori P52569.

    Family and domain databases

    InterProi IPR002293. AA/rel_permease1.
    IPR004755. Cat_AA_permease.
    IPR029485. CAT_C.
    [Graphical view ]
    PANTHERi PTHR11785. PTHR11785. 1 hit.
    Pfami PF13520. AA_permease_2. 1 hit.
    PF13906. AA_permease_C. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF006060. AA_transporter. 1 hit.
    TIGRFAMsi TIGR00906. 2A0303. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning, tissue distribution, and chromosomal localization of human cationic amino acid transporter 2 (HCAT2)."
      Hoshide R., Ikeda Y., Karashima S., Matsuura T., Komaki S., Kishino T., Niikawa N., Endo F., Matsuda I.
      Genomics 38:174-178(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Intestine.
    2. "Human cationic amino acid transporters hCAT-1, hCAT-2A, and hCAT-2B: three related carriers with distinct transport properties."
      Closs E.I., Graef P., Habermeier A., Cunningham J.M., Foerstermann U.
      Biochemistry 36:6462-6468(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [MRNA] OF 337-469 (ISOFORM 1), FUNCTION, VARIANT THR-531.
      Tissue: Liver.
    3. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT THR-531.
      Tissue: Liver.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-658 (ISOFORM 2).
      Tissue: Skeletal muscle.
    7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-646, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-455, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiCTR2_HUMAN
    AccessioniPrimary (citable) accession number: P52569
    Secondary accession number(s): B7ZL54
    , O15291, O15292, Q14CQ6, Q6NSZ7, Q86TC6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: February 20, 2007
    Last modified: October 1, 2014
    This is version 131 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3