Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P52569 (CTR2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 129. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Low affinity cationic amino acid transporter 2

Short name=CAT-2
Short name=CAT2
Alternative name(s):
Solute carrier family 7 member 2
Gene names
Name:SLC7A2
Synonyms:ATRC2, CAT2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length658 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages By similarity. Ref.2

Subcellular location

Membrane; Multi-pass membrane protein.

Tissue specificity

Expressed at high levels in the skeletal muscle, placenta and ovary. Expressed at intermediate levels in the liver and pancreas and at low levels in the kidney and heart. Ref.1

Sequence similarities

Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family. [View classification]

Sequence caution

The sequence AAH69648.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAI04906.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAI13662.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAI43584.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Isoform 2: The sequence AAB62810.1 differs from that shown. Reason: Frameshift at position 29.

Ontologies

Keywords
   Biological processAmino-acid transport
Transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   PTMGlycoprotein
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processamino acid transport

Traceable author statement. Source: Reactome

cellular amino acid metabolic process

Traceable author statement Ref.1. Source: ProtInc

ion transport

Traceable author statement. Source: Reactome

macrophage activation

Inferred from electronic annotation. Source: Ensembl

nitric oxide biosynthetic process

Inferred from electronic annotation. Source: Ensembl

nitric oxide production involved in inflammatory response

Inferred from electronic annotation. Source: Ensembl

regulation of inflammatory response

Inferred from electronic annotation. Source: Ensembl

regulation of macrophage activation

Inferred from electronic annotation. Source: Ensembl

transmembrane transport

Traceable author statement. Source: Reactome

transport

Traceable author statement Ref.1. Source: ProtInc

   Cellular_componentintegral component of plasma membrane

Traceable author statement Ref.1. Source: ProtInc

membrane

Traceable author statement Ref.1. Source: ProtInc

plasma membrane

Traceable author statement. Source: Reactome

   Molecular_functionL-lysine transmembrane transporter activity

Inferred from electronic annotation. Source: Ensembl

L-ornithine transmembrane transporter activity

Inferred from electronic annotation. Source: Ensembl

basic amino acid transmembrane transporter activity

Traceable author statement Ref.1. Source: ProtInc

high affinity arginine transmembrane transporter activity

Inferred from electronic annotation. Source: Ensembl

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P52569-1)

Also known as: CAT-2B;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P52569-2)

Also known as: CAT-2A;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPSSDVRM
     357-398: IFPMPRVIYA...IATLSSGAVA → MFPLPRILFA...AATLTAGVIS
Isoform 3 (identifier: P52569-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPSSDVRM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 658658Low affinity cationic amino acid transporter 2
PRO_0000054264

Regions

Topological domain1 – 3737Cytoplasmic Potential
Transmembrane38 – 5922Helical; Potential
Topological domain60 – 634Extracellular Potential
Transmembrane64 – 8421Helical; Potential
Topological domain85 – 10420Cytoplasmic Potential
Transmembrane105 – 12521Helical; Potential
Topological domain126 – 16338Extracellular Potential
Transmembrane164 – 18421Helical; Potential
Topological domain185 – 1928Cytoplasmic Potential
Transmembrane193 – 21321Helical; Potential
Topological domain214 – 24835Extracellular Potential
Transmembrane249 – 26921Helical; Potential
Topological domain270 – 28920Cytoplasmic Potential
Transmembrane290 – 30920Helical; Potential
Topological domain310 – 33930Extracellular Potential
Transmembrane340 – 36021Helical; Potential
Topological domain361 – 38626Cytoplasmic Potential
Transmembrane387 – 40721Helical; Potential
Topological domain408 – 4103Extracellular Potential
Transmembrane411 – 43121Helical; Potential
Topological domain432 – 49059Cytoplasmic Potential
Transmembrane491 – 51121Helical; Potential
Topological domain512 – 52413Extracellular Potential
Transmembrane525 – 54925Helical; Potential
Topological domain550 – 5578Cytoplasmic Potential
Transmembrane558 – 57821Helical; Potential
Topological domain579 – 5824Extracellular Potential
Transmembrane583 – 60321Helical; Potential
Topological domain604 – 65855Cytoplasmic Potential

Amino acid modifications

Modified residue4551Phosphoserine Ref.8
Modified residue6461Phosphoserine Ref.7
Glycosylation1571N-linked (GlcNAc...) Potential
Glycosylation2271N-linked (GlcNAc...) Potential
Glycosylation2391N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence11M → MKIETSGYNSDKLICRGFIG TPAPPVCDSKFLLSPSSDVR M in isoform 2 and isoform 3.
VSP_037354
Alternative sequence357 – 39842IFPMP…SGAVA → MFPLPRILFAMARDGLLFRF LARVSKRQSPVAATLTAGVI S in isoform 2.
VSP_023354
Natural variant201V → M.
Corresponds to variant rs12680645 [ dbSNP | Ensembl ].
VAR_030799
Natural variant3761C → F.
Corresponds to variant rs1134975 [ dbSNP | Ensembl ].
VAR_030800
Natural variant5311A → T. Ref.2 Ref.5
Corresponds to variant rs62622371 [ dbSNP | Ensembl ].
VAR_030801
Natural variant5471Q → L.
Corresponds to variant rs1981498 [ dbSNP | Ensembl ].
VAR_058414

Experimental info

Sequence conflict1341W → G in BAA06271. Ref.1
Sequence conflict3641I → N in BAA06271. Ref.1
Sequence conflict5201T → Y in BAA06271. Ref.1
Sequence conflict5521Q → R in BAA06271. Ref.1
Sequence conflict5661A → T in BAA06271. Ref.1
Sequence conflict5681S → T in BAA06271. Ref.1
Sequence conflict6051H → R in CAD89909. Ref.6
Sequence conflict6191D → V in CAD89909. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (CAT-2B) [UniParc].

Last modified February 20, 2007. Version 2.
Checksum: 633FD86A333E9208

FASTA65871,673
        10         20         30         40         50         60 
MIPCRAALTF ARCLIRRKIV TLDSLEDTKL CRCLSTMDLI ALGVGSTLGA GVYVLAGEVA 

        70         80         90        100        110        120 
KADSGPSIVV SFLIAALASV MAGLCYAEFG ARVPKTGSAY LYTYVTVGEL WAFITGWNLI 

       130        140        150        160        170        180 
LSYVIGTSSV ARAWSGTFDE LLSKQIGQFL RTYFRMNYTG LAEYPDFFAV CLILLLAGLL 

       190        200        210        220        230        240 
SFGVKESAWV NKVFTAVNIL VLLFVMVAGF VKGNVANWKI SEEFLKNISA SAREPPSENG 

       250        260        270        280        290        300 
TSIYGAGGFM PYGFTGTLAG AATCFYAFVG FDCIATTGEE VRNPQKAIPI GIVTSLLVCF 

       310        320        330        340        350        360 
MAYFGVSAAL TLMMPYYLLD EKSPLPVAFE YVGWGPAKYV VAAGSLCALS TSLLGSIFPM 

       370        380        390        400        410        420 
PRVIYAMAED GLLFKCLAQI NSKTKTPIIA TLSSGAVAAL MAFLFDLKAL VDMMSIGTLM 

       430        440        450        460        470        480 
AYSLVAACVL ILRYQPGLSY DQPKCSPEKD GLGSSPRVTS KSESQVTMLQ RQGFSMRTLF 

       490        500        510        520        530        540 
CPSLLPTQQS ASLVSFLVGF LAFLVLGLSV LTTYGVHAIT RLEAWSLALL ALFLVLFVAI 

       550        560        570        580        590        600 
VLTIWRQPQN QQKVAFMVPF LPFLPAFSIL VNIYLMVQLS ADTWVRFSIW MAIGFLIYFS 

       610        620        630        640        650 
YGIRHSLEGH LRDENNEEDA YPDNVHAAAE EKSAIQANDH HPRNLSSPFI FHEKTSEF 

« Hide

Isoform 2 (CAT-2A) [UniParc].

Checksum: A5753DDB8FF1FFFA
Show »

FASTA69776,024
Isoform 3 [UniParc].

Checksum: 6ED2F36C607015C0
Show »

FASTA69875,986

References

« Hide 'large scale' references
[1]"Molecular cloning, tissue distribution, and chromosomal localization of human cationic amino acid transporter 2 (HCAT2)."
Hoshide R., Ikeda Y., Karashima S., Matsuura T., Komaki S., Kishino T., Niikawa N., Endo F., Matsuda I.
Genomics 38:174-178(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Intestine.
[2]"Human cationic amino acid transporters hCAT-1, hCAT-2A, and hCAT-2B: three related carriers with distinct transport properties."
Closs E.I., Graef P., Habermeier A., Cunningham J.M., Foerstermann U.
Biochemistry 36:6462-6468(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [MRNA] OF 337-469 (ISOFORM 1), FUNCTION, VARIANT THR-531.
Tissue: Liver.
[3]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT THR-531.
Tissue: Liver.
[6]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-658 (ISOFORM 2).
Tissue: Skeletal muscle.
[7]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-646, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-455, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D29990 mRNA. Translation: BAA06271.1.
U76368 mRNA. Translation: AAB62810.1. Frameshift.
U76369 mRNA. Translation: AAB62811.1.
AB020863 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63813.1.
BC069648 mRNA. Translation: AAH69648.1. Different initiation.
BC104905 mRNA. Translation: AAI04906.1. Different initiation.
BC113661 mRNA. Translation: AAI13662.1. Different initiation.
BC143583 mRNA. Translation: AAI43584.1. Different initiation.
AL832016 mRNA. Translation: CAD89909.1.
CCDSCCDS34852.1. [P52569-1]
CCDS55203.1. [P52569-3]
CCDS6002.2. [P52569-2]
RefSeqNP_001008539.3. NM_001008539.3. [P52569-1]
NP_001158243.1. NM_001164771.1. [P52569-3]
NP_003037.4. NM_003046.5. [P52569-2]
XP_005273667.1. XM_005273610.2. [P52569-1]
XP_005273668.1. XM_005273611.2. [P52569-1]
XP_005273669.1. XM_005273612.2. [P52569-1]
UniGeneHs.448520.

3D structure databases

ProteinModelPortalP52569.
SMRP52569. Positions 34-425.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid112433. 1 interaction.
IntActP52569. 1 interaction.

Chemistry

DrugBankDB00123. L-Lysine.
DB00129. L-Ornithine.

Protein family/group databases

TCDB2.A.3.3.8. the amino acid-polyamine-organocation (apc) family.

PTM databases

PhosphoSiteP52569.

Polymorphism databases

DMDM126302539.

Proteomic databases

MaxQBP52569.
PaxDbP52569.
PRIDEP52569.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000004531; ENSP00000004531; ENSG00000003989. [P52569-3]
ENST00000398090; ENSP00000381164; ENSG00000003989. [P52569-2]
ENST00000470360; ENSP00000419873; ENSG00000003989. [P52569-2]
ENST00000494857; ENSP00000419140; ENSG00000003989. [P52569-1]
ENST00000522656; ENSP00000430464; ENSG00000003989. [P52569-1]
GeneID6542.
KEGGhsa:6542.
UCSCuc011kyc.2. human. [P52569-1]
uc011kyd.2. human. [P52569-2]
uc011kye.2. human. [P52569-3]

Organism-specific databases

CTD6542.
GeneCardsGC08P017354.
HGNCHGNC:11060. SLC7A2.
HPAHPA009169.
MIM601872. gene.
neXtProtNX_P52569.
PharmGKBPA35920.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0531.
HOGENOMHOG000250623.
HOVERGENHBG000280.
KOK13864.
OMAVPYVNTW.
OrthoDBEOG72C501.
PhylomeDBP52569.
TreeFamTF315212.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.
REACT_19419. Amino acid and oligopeptide SLC transporters.

Gene expression databases

BgeeP52569.
CleanExHS_SLC7A2.
GenevestigatorP52569.

Family and domain databases

InterProIPR002293. AA/rel_permease1.
IPR004755. Cat_AA_permease.
IPR029485. CAT_C.
[Graphical view]
PANTHERPTHR11785. PTHR11785. 1 hit.
PfamPF13520. AA_permease_2. 1 hit.
PF13906. AA_permease_C. 1 hit.
[Graphical view]
PIRSFPIRSF006060. AA_transporter. 1 hit.
TIGRFAMsTIGR00906. 2A0303. 1 hit.
ProtoNetSearch...

Other

ChiTaRSSLC7A2. human.
GeneWikiSLC7A2.
GenomeRNAi6542.
NextBio25455.
PROP52569.
SOURCESearch...

Entry information

Entry nameCTR2_HUMAN
AccessionPrimary (citable) accession number: P52569
Secondary accession number(s): B7ZL54 expand/collapse secondary AC list , O15291, O15292, Q14CQ6, Q6NSZ7, Q86TC6
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: February 20, 2007
Last modified: July 9, 2014
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM