P52569 (CTR2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Low affinity cationic amino acid transporter 2 Short name=CAT-2 Short name=CAT2 Alternative name(s): Solute carrier family 7 member 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 658 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). Plays a regulatory role in classical or alternative activation of macrophages By similarity. Ref.2 |
| Subcellular location | |
| Tissue specificity | Expressed at high levels in the skeletal muscle, placenta and ovary. Expressed at intermediate levels in the liver and pancreas and at low levels in the kidney and heart. Ref.1 |
| Sequence similarities | Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family. [View classification] |
| Sequence caution | The sequence AAH69648.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAI04906.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAI13662.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAI43584.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. Isoform 2: The sequence AAB62810.1 differs from that shown. Reason: Frameshift at position 29. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P52569-1) Also known as: CAT-2B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P52569-2) Also known as: CAT-2A; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPSSDVRM 357-398: IFPMPRVIYA...IATLSSGAVA → MFPLPRILFA...AATLTAGVIS | ||||||
| Isoform 3 (identifier: P52569-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKIETSGYNSDKLICRGFIGTPAPPVCDSKFLLSPSSDVRM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 658 | 658 | Low affinity cationic amino acid transporter 2 | PRO_0000054264 | |||||
Regions | |||||||||
| Topological domain | 1 – 37 | 37 | Cytoplasmic Potential | ||||||
| Transmembrane | 38 – 59 | 22 | Helical; Potential | ||||||
| Topological domain | 60 – 63 | 4 | Extracellular Potential | ||||||
| Transmembrane | 64 – 84 | 21 | Helical; Potential | ||||||
| Topological domain | 85 – 104 | 20 | Cytoplasmic Potential | ||||||
| Transmembrane | 105 – 125 | 21 | Helical; Potential | ||||||
| Topological domain | 126 – 163 | 38 | Extracellular Potential | ||||||
| Transmembrane | 164 – 184 | 21 | Helical; Potential | ||||||
| Topological domain | 185 – 192 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 193 – 213 | 21 | Helical; Potential | ||||||
| Topological domain | 214 – 248 | 35 | Extracellular Potential | ||||||
| Transmembrane | 249 – 269 | 21 | Helical; Potential | ||||||
| Topological domain | 270 – 289 | 20 | Cytoplasmic Potential | ||||||
| Transmembrane | 290 – 309 | 20 | Helical; Potential | ||||||
| Topological domain | 310 – 339 | 30 | Extracellular Potential | ||||||
| Transmembrane | 340 – 360 | 21 | Helical; Potential | ||||||
| Topological domain | 361 – 386 | 26 | Cytoplasmic Potential | ||||||
| Transmembrane | 387 – 407 | 21 | Helical; Potential | ||||||
| Topological domain | 408 – 410 | 3 | Extracellular Potential | ||||||
| Transmembrane | 411 – 431 | 21 | Helical; Potential | ||||||
| Topological domain | 432 – 490 | 59 | Cytoplasmic Potential | ||||||
| Transmembrane | 491 – 511 | 21 | Helical; Potential | ||||||
| Topological domain | 512 – 524 | 13 | Extracellular Potential | ||||||
| Transmembrane | 525 – 549 | 25 | Helical; Potential | ||||||
| Topological domain | 550 – 557 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 558 – 578 | 21 | Helical; Potential | ||||||
| Topological domain | 579 – 582 | 4 | Extracellular Potential | ||||||
| Transmembrane | 583 – 603 | 21 | Helical; Potential | ||||||
| Topological domain | 604 – 658 | 55 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 455 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 646 | 1 | Phosphoserine Ref.7 | ||||||
| Glycosylation | 157 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 227 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 239 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MKIETSGYNSDKLICRGFIG TPAPPVCDSKFLLSPSSDVR M in isoform 2 and isoform 3. | VSP_037354 | |||||
| Alternative sequence | 357 – 398 | 42 | IFPMP…SGAVA → MFPLPRILFAMARDGLLFRF LARVSKRQSPVAATLTAGVI S in isoform 2. | VSP_023354 | |||||
| Natural variant | 20 | 1 | V → M. Corresponds to variant rs12680645 [ dbSNP | Ensembl ]. | VAR_030799 | |||||
| Natural variant | 376 | 1 | C → F. Corresponds to variant rs1134975 [ dbSNP | Ensembl ]. | VAR_030800 | |||||
| Natural variant | 531 | 1 | A → T. Ref.2 Ref.5 Corresponds to variant rs62622371 [ dbSNP | Ensembl ]. | VAR_030801 | |||||
| Natural variant | 547 | 1 | Q → L. Corresponds to variant rs1981498 [ dbSNP | Ensembl ]. | VAR_058414 | |||||
Experimental info | |||||||||
| Sequence conflict | 134 | 1 | W → G in BAA06271. Ref.1 | ||||||
| Sequence conflict | 364 | 1 | I → N in BAA06271. Ref.1 | ||||||
| Sequence conflict | 520 | 1 | T → Y in BAA06271. Ref.1 | ||||||
| Sequence conflict | 552 | 1 | Q → R in BAA06271. Ref.1 | ||||||
| Sequence conflict | 566 | 1 | A → T in BAA06271. Ref.1 | ||||||
| Sequence conflict | 568 | 1 | S → T in BAA06271. Ref.1 | ||||||
| Sequence conflict | 605 | 1 | H → R in CAD89909. Ref.6 | ||||||
| Sequence conflict | 619 | 1 | D → V in CAD89909. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning, tissue distribution, and chromosomal localization of human cationic amino acid transporter 2 (HCAT2)." Hoshide R., Ikeda Y., Karashima S., Matsuura T., Komaki S., Kishino T., Niikawa N., Endo F., Matsuda I. Genomics 38:174-178(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Intestine. |
| [2] | "Human cationic amino acid transporters hCAT-1, hCAT-2A, and hCAT-2B: three related carriers with distinct transport properties." Closs E.I., Graef P., Habermeier A., Cunningham J.M., Foerstermann U. Biochemistry 36:6462-6468(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [MRNA] OF 337-469 (ISOFORM 1), FUNCTION, VARIANT THR-531. Tissue: Liver. |
| [3] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT THR-531. Tissue: Liver. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-658 (ISOFORM 2). Tissue: Skeletal muscle. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-646, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-455, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D29990 mRNA. Translation: BAA06271.1. U76368 mRNA. Translation: AAB62810.1. Frameshift. U76369 mRNA. Translation: AAB62811.1. AB020863 Genomic DNA. No translation available. CH471080 Genomic DNA. Translation: EAW63813.1. BC069648 mRNA. Translation: AAH69648.1. Different initiation. BC104905 mRNA. Translation: AAI04906.1. Different initiation. BC113661 mRNA. Translation: AAI13662.1. Different initiation. BC143583 mRNA. Translation: AAI43584.1. Different initiation. AL832016 mRNA. Translation: CAD89909.1. |
| IPI | IPI00003819. IPI00873323. IPI00930563. |
| RefSeq | NP_001008539.3. NM_001008539.3. NP_001158243.1. NM_001164771.1. NP_003037.4. NM_003046.5. |
| UniGene | Hs.448520. |
3D structure databases | |
| ProteinModelPortal | P52569. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P52569. 1 interaction. |
PTM databases | |
| PhosphoSite | P52569. |
Polymorphism databases | |
| DMDM | 126302539. |
Proteomic databases | |
| PaxDb | P52569. |
| PRIDE | P52569. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000004531; ENSP00000004531; ENSG00000003989. ENST00000398090; ENSP00000381164; ENSG00000003989. ENST00000470360; ENSP00000419873; ENSG00000003989. ENST00000494857; ENSP00000419140; ENSG00000003989. ENST00000522656; ENSP00000430464; ENSG00000003989. |
| GeneID | 6542. |
| KEGG | hsa:6542. |
| UCSC | uc011kyc.2. human. uc011kyd.2. human. uc011kye.2. human. |
Organism-specific databases | |
| CTD | 6542. |
| GeneCards | GC08P017354. |
| HGNC | HGNC:11060. SLC7A2. |
| HPA | HPA009169. |
| MIM | 601872. gene. |
| neXtProt | NX_P52569. |
| PharmGKB | PA35920. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0531. |
| HOGENOM | HOG000250623. |
| HOVERGEN | HBG000280. |
| KO | K13864. |
| OMA | NSDKLIC. |
| OrthoDB | EOG46143S. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. REACT_19419. Amino acid and oligopeptide SLC transporters. |
Gene expression databases | |
| Bgee | P52569. |
| CleanEx | HS_SLC7A2. |
| Genevestigator | P52569. |
| GermOnline | ENSG00000003989. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002293. AA/rel_permease1. IPR015606. Cat-AATrans. IPR004755. Cat_AA_permease. [Graphical view] |
| PANTHER | PTHR11785. PTHR11785. 1 hit. PTHR11785:SF53. PTHR11785:SF53. 1 hit. |
| PIRSF | PIRSF006060. AA_transporter. 1 hit. |
| TIGRFAMs | TIGR00906. 2A0303. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SLC7A2. human. |
| DrugBank | DB00123. L-Lysine. DB00129. L-Ornithine. |
| GenomeRNAi | 6542. |
| NextBio | 25455. |
| SOURCE | Search... |
Entry information
| Entry name | CTR2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P52569 Secondary accession number(s): B7ZL54 Q86TC6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
