P52034 (K6PF_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 6-phosphofructokinase Short name=Phosphofructokinase EC=2.7.1.11 Alternative name(s): Phosphohexokinase | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 788 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | ATP + D-fructose 6-phosphate = ADP + D-fructose 1,6-bisphosphate. |
| Pathway | |
| Sequence similarities | Belongs to the phosphofructokinase family. Two domains subfamily. |
| Sequence caution | The sequence AAN71109.1 differs from that shown. Reason: Frameshift at position 218. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Glycolysis |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Transferase |
| Technical term | Allosteric enzyme Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | fructose 6-phosphate metabolic process Inferred from electronic annotation. Source: InterPro glycolysisInferred from mutant phenotype Ref.1. Source: FlyBase |
| Cellular_component | 6-phosphofructokinase complex Inferred by curator Ref.1. Source: FlyBase |
| Molecular_function | 6-phosphofructokinase activity Inferred from mutant phenotype Ref.1. Source: FlyBase ATP bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B (identifier: P52034-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: P52034-2) The sequence of this isoform differs from the canonical sequence as follows: 1-15: MNSEINQRFLARGSQ → MHSIKFRVFT...IDFVHPVKPF | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform C (identifier: P52034-3) The sequence of this isoform differs from the canonical sequence as follows: 219-250: LVGGLACEADFIFIPEMPPKVDWPDRLCSQLA → ISAAIATEADFMFIPEEPVSVNWKDEICVKLH | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 788 | 788 | 6-phosphofructokinase | PRO_0000112031 | |||||
Regions | |||||||||
| Nucleotide binding | 37 – 41 | 5 | ATP By similarity | ||||||
| Nucleotide binding | 212 – 228 | 17 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 168 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 203 | 1 | Substrate By similarity | ||||||
| Binding site | 294 | 1 | Substrate By similarity | ||||||
| Binding site | 300 | 1 | Substrate By similarity | ||||||
| Binding site | 303 | 1 | Substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 15 | 15 | MNSEI…ARGSQ → MHSIKFRVFTKLKPIFLEIN GRIPICRHFHGPTTFRLEIS NKTPPIRQKLTFPNIGIQCT RSHHLCCPRDISGNTLLSVK FNCKRHCIKLRSDSGDQKND SPGEKNIQKDKSAQRCGKPI NNLHNGFLNAVNYSEKNAVK KKKSAPKRKCGKSVDELRKC LRTMQDVIDFVHPVKPF in isoform A. | VSP_014950 | |||||
| Alternative sequence | 219 – 250 | 32 | LVGGL…CSQLA → ISAAIATEADFMFIPEEPVS VNWKDEICVKLH in isoform C. | VSP_014951 | |||||
Experimental info | |||||||||
| Sequence conflict | 68 – 70 | 3 | QEA → RKS in AAA62385. Ref.1 | ||||||
| Sequence conflict | 80 – 92 | 13 | HRGGT…SARCQ → PFVGWHHPLLRPLP Ref.1 | ||||||
| Sequence conflict | 130 – 131 | 2 | FR → LP in AAA62385. Ref.1 | ||||||
| Sequence conflict | 160 – 161 | 2 | IV → ML in AAA62385. Ref.1 | ||||||
| Sequence conflict | 190 – 199 | 10 | AIDAISSTAY → QSKAKVQSPVQPN in AAA62385. Ref.1 | ||||||
| Sequence conflict | 209 – 212 | 4 | VMGR → GQVS in AAA62385. Ref.1 | ||||||
| Sequence conflict | 228 – 252 | 25 | DFIFI…QLAQE → IHIHPNAPGRLGQTGSALSW TQ in AAA62385. Ref.1 | ||||||
| Sequence conflict | 313 | 1 | I → F in AAA62385. Ref.1 | ||||||
| Sequence conflict | 322 – 325 | 4 | ATLA → PLWP in AAA62385. Ref.1 | ||||||
| Sequence conflict | 360 – 361 | 2 | VA → G in AAA62385. Ref.1 | ||||||
| Sequence conflict | 374 – 375 | 2 | KL → NV in AAA62385. Ref.1 | ||||||
| Sequence conflict | 455 | 1 | G → R in AAA62385. Ref.1 | ||||||
| Sequence conflict | 478 | 1 | T → S in AAA62385. Ref.1 | ||||||
| Sequence conflict | 522 – 526 | 5 | DNYPQ → TTTHS in AAA62385. Ref.1 | ||||||
| Sequence conflict | 590 – 591 | 2 | AT → PP in AAA62385. Ref.1 | ||||||
| Sequence conflict | 613 | 1 | D → E in AAA62385. Ref.1 | ||||||
| Sequence conflict | 622 – 636 | 15 | ASKMA…GLILR → PPRWPRRLPRSNPA in AAA62385. Ref.1 | ||||||
| Sequence conflict | 695 – 705 | 11 | WLAAQIKANID → CWPPRSRRTST in AAA62385. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure and expression of the gene encoding phosphofructokinase (PFK) in Drosophila melanogaster." Currie P.D., Sullivan D.T. J. Biol. Chem. 269:24679-24687(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM B). Strain: Oregon-R. |
| [2] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [3] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [4] | "A Drosophila complementary DNA resource." Rubin G.M., Hong L., Brokstein P., Evans-Holm M., Frise E., Stapleton M., Harvey D.A. Science 287:2222-2224(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Strain: Berkeley. Tissue: Head. |
| [5] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 101-788 (ISOFORM C). Strain: Berkeley. Tissue: Testis. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L27653 Genomic DNA. Translation: AAA62385.1. AE013599 Genomic DNA. Translation: AAF58840.1. AE013599 Genomic DNA. Translation: AAF58841.1. AE013599 Genomic DNA. Translation: AAM71065.2. AF145673 mRNA. Translation: AAD38648.1. BT001354 mRNA. Translation: AAN71109.1. Frameshift. |
| PIR | A55034. |
| RefSeq | NP_523676.1. NM_078952.3. NP_724890.1. NM_165746.3. NP_724891.2. NM_165747.4. |
| UniGene | Dm.7095. |
3D structure databases | |
| ProteinModelPortal | P52034. |
| SMR | P52034. Positions 18-766. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-928619. |
Proteomic databases | |
| PaxDb | P52034. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0088422; FBpp0087508; FBgn0003071. |
| GeneID | 36060. |
| KEGG | dme:Dmel_CG4001. |
| UCSC | CG4001-RA. d. melanogaster. |
Organism-specific databases | |
| CTD | 36060. |
| FlyBase | FBgn0003071. Pfk. |
Phylogenomic databases | |
| eggNOG | COG0205. |
| GeneTree | ENSGT00390000013209. |
| HOGENOM | HOG000148827. |
| InParanoid | P52034. |
| KO | K00850. |
| OrthoDB | EOG4PNVXS. |
Enzyme and pathway databases | |
| UniPathway | UPA00109; UER00182. |
Gene expression databases | |
| Bgee | P52034. |
| GermOnline | CG4001. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR009161. 6-phosphofructokinase_euk. IPR022953. Phosphofructokinase. IPR015912. Phosphofructokinase_CS. IPR000023. Phosphofructokinase_dom. [Graphical view] |
| Pfam | PF00365. PFK. 2 hits. [Graphical view] |
| PIRSF | PIRSF000533. ATP_PFK_euk. 1 hit. |
| PRINTS | PR00476. PHFRCTKINASE. |
| SUPFAM | SSF53784. Ppfruckinase. 2 hits. |
| TIGRFAMs | TIGR02478. 6PF1K_euk. 1 hit. |
| PROSITE | PS00433. PHOSPHOFRUCTOKINASE. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 36060. |
| NextBio | 796655. |
Entry information
| Entry name | K6PF_DROME | ||||||||
| Accession | Primary (citable) accession number: P52034 Secondary accession number(s): Q8IH94 Q9Y100 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
