Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P51944

- CCNF_MOUSE

UniProt

P51944 - CCNF_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cyclin-F

Gene

Ccnf

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of CP110 during G2 phase, thereby acting as an inhibitor of centrosome reduplication.By similarity

GO - Biological processi

  1. mitotic nuclear division Source: UniProtKB-KW
  2. negative regulation of centrosome duplication Source: UniProtKB
  3. placenta development Source: MGI
  4. protein ubiquitination Source: UniProtKB
  5. re-entry into mitotic cell cycle Source: MGI
  6. SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Cyclin

Keywords - Biological processi

Cell cycle, Cell division, Mitosis, Ubl conjugation pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-F
Gene namesi
Name:Ccnf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 17

Organism-specific databases

MGIiMGI:102551. Ccnf.

Subcellular locationi

Nucleus By similarity. Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole By similarity
Note: Localization in the centrosome is rare in S phase cells and increases in G2 cells, Localizes on both the mother and daughter centrioles. Localization to centrosomes is not dependent on CP110. Also localizes to the nucleus (By similarity).By similarity

GO - Cellular componenti

  1. centriole Source: UniProtKB
  2. nucleus Source: UniProtKB
  3. SCF ubiquitin ligase complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Disruption phenotypei

Death by embryonic day 10.5 (E10.5), with many developmental anomalies due in part to failures in yolk sac and chorioallantoic placentation. Heterozygous mice are normal and fertile.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 777777Cyclin-FPRO_0000080464Add
BLAST

Post-translational modificationi

Degraded when the spindle assembly checkpoint is activated during the G2-M transition. Degradation is not dependent on the proteasome or ubiquitin and depends on the C-terminal PEST sequence (By similarity).By similarity
Phosphorylated just before cells enter into mitosis.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiP51944.

PTM databases

PhosphoSiteiP51944.

Expressioni

Inductioni

Expression is activated by the FOXM1 transcription factor.2 Publications

Gene expression databases

BgeeiP51944.
CleanExiMM_CCNF.
GenevestigatoriP51944.

Interactioni

Subunit structurei

Component of the SCF(CCNF) complex consisting of CUL1, RBX1, SKP1 and CCNF. Interacts with CCNB1; interaction is required for nuclear localization of CCNB1. Interacts with CCP110; this interaction leads to CCP110 ubiquitination and degradation via the proteasome pathway (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000111048.

Structurei

3D structure databases

ProteinModelPortaliP51944.
SMRiP51944. Positions 302-526.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini29 – 7648F-boxPROSITE-ProRule annotationAdd
BLAST
Domaini295 – 405111Cyclin N-terminalAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni582 – 761180PESTAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi20 – 289Nuclear localization signal 1By similarity
Motifi568 – 5747Nuclear localization signal 2By similarity

Domaini

The nuclear localization signals mediate the localization to the nucleus and are required for CCNB1 localization to the nucleus.By similarity

Sequence similaritiesi

Belongs to the cyclin family. Cyclin AB subfamily.Curated
Contains 1 cyclin N-terminal domain.Curated
Contains 1 F-box domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG5024.
GeneTreeiENSGT00730000111208.
HOVERGENiHBG050838.
InParanoidiP51944.
KOiK10289.
OMAiKSCLQCR.
OrthoDBiEOG7WDN1V.
PhylomeDBiP51944.
TreeFamiTF101006.

Family and domain databases

Gene3Di1.10.472.10. 2 hits.
InterProiIPR028857. CCNF_metazoan.
IPR013763. Cyclin-like.
IPR004367. Cyclin_C-dom.
IPR006671. Cyclin_N.
IPR001810. F-box_dom.
[Graphical view]
PANTHERiPTHR10177:SF183. PTHR10177:SF183. 1 hit.
PfamiPF02984. Cyclin_C. 1 hit.
PF00134. Cyclin_N. 1 hit.
PF00646. F-box. 1 hit.
[Graphical view]
SMARTiSM00385. CYCLIN. 2 hits.
SM00256. FBOX. 1 hit.
[Graphical view]
SUPFAMiSSF47954. SSF47954. 2 hits.
SSF81383. SSF81383. 1 hit.
PROSITEiPS00292. CYCLINS. 1 hit.
PS50181. FBOX. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P51944-1) [UniParc]FASTAAdd to Basket

Also known as: Short

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSGGVIHCR CAKCFCYPTK RRIKRRPRNL TILSLPEDVL FHILKWLSVG
60 70 80 90 100
DILAVRAVHS HLKYLVDNHA SVWASASFQE LWPSPQNLKL FERAAEKGNF
110 120 130 140 150
EAAVKLGIAY LYNEGLSVSD EACAEVNGLK ASRFFSMAER LNTGSEPFIW
160 170 180 190 200
LFIRPPWSVS GSCCKAVVHD SLRAECQLQR SHKASILHCL GRVLNLFEDE
210 220 230 240 250
EKRKQARSLL EESSRQGCLI SSYLLWESDR KVDMSDPGRC LHSFRKLRDY
260 270 280 290 300
AAKGCWEAQL ALAKACAGGS QLGLEGKACS ESVCQLFQAS QAVNKQQIFS
310 320 330 340 350
VQKGLSDTMR YILIDWLVEV ATMKDFTSLC LHLTVECVDR YLRRRLVPRY
360 370 380 390 400
KLQLLGIACM VICTRFISKE ILTIREAVWL TDNTYKYEDL VRVMGEIISA
410 420 430 440 450
LEGKIRIPTV VDYKEVLLTL VPVAPRTQHL CSFLCELTLL HTSLSIYAPA
460 470 480 490 500
RLASAALLLA RLMHGQTQPW TTHLWDLTGF SYSDLVPCVL SLHKKCFHDD
510 520 530 540 550
APKDYRQVSL TAVKQRFEDK CYEEISREEV LSYADLCSTI GVKQESPEPP
560 570 580 590 600
SFPSSGEIHT FLSSPSGRRS KRKRENSLQE DRGSFVTTPT AELSNQEETL
610 620 630 640 650
LGSLLDWSLE CCSGYEGDQE SEGEKEGDVT APSRLLDVTV VYLNPEEHCC
660 670 680 690 700
QESSDEEAWP EDKIHPAPGT QAPPASAPRP LLCNRGDRAK DITTSGYSSV
710 720 730 740 750
SSSSPISSLD GGMGGSPQST SVLSVGSHSS TKPCHHQAKK SCLQCRPPNS
760 770
PESGVHQQPV KRQNLSVHSD KDMHLAS
Length:777
Mass (Da):86,623
Last modified:October 5, 2010 - v2
Checksum:i1FDA471590793DD6
GO
Isoform 2 (identifier: P51944-2) [UniParc]FASTAAdd to Basket

Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
     5-5: G → GGECWRDGVGDRSYGTEAGGAWTRAPVTRECASHPPKHGV

Show »
Length:816
Mass (Da):90,759
Checksum:iC6B4284932DDD381
GO
Isoform 3 (identifier: P51944-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-233: Missing.

Note: No experimental confirmation available.

Show »
Length:775
Mass (Da):86,409
Checksum:i3AFF206EED11CF53
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti81 – 811L → P in AAA62317. 1 PublicationCurated
Sequence conflicti81 – 811L → P in AAA63152. 1 PublicationCurated
Sequence conflicti92 – 921E → Q in CAA87695. (PubMed:7767003)Curated
Sequence conflicti132 – 1321S → T in CAA87695. (PubMed:7767003)Curated
Sequence conflicti247 – 2471L → H in BAC26886. (PubMed:16141072)Curated
Sequence conflicti263 – 2631A → T in AAA62317. 1 PublicationCurated
Sequence conflicti263 – 2631A → T in AAA63152. 1 PublicationCurated
Sequence conflicti290 – 2901S → T in AAA62317. 1 PublicationCurated
Sequence conflicti290 – 2901S → T in AAA63152. 1 PublicationCurated
Sequence conflicti301 – 3011V → G in CAA87695. (PubMed:7767003)Curated
Sequence conflicti364 – 3641T → S in AAA62317. 1 PublicationCurated
Sequence conflicti364 – 3641T → S in AAA63152. 1 PublicationCurated
Sequence conflicti454 – 4541S → A in CAA87695. (PubMed:7767003)Curated
Sequence conflicti464 – 4641H → R in AAA62317. 1 PublicationCurated
Sequence conflicti464 – 4641H → R in AAA63152. 1 PublicationCurated
Sequence conflicti508 – 5081V → I in CAA87695. (PubMed:7767003)Curated
Sequence conflicti508 – 5081V → I in AAA62317. 1 PublicationCurated
Sequence conflicti508 – 5081V → I in AAA63152. 1 PublicationCurated
Sequence conflicti508 – 5081V → I in AAH37662. (PubMed:15489334)Curated
Sequence conflicti527 – 5271R → Q in CAA87695. (PubMed:7767003)Curated
Sequence conflicti539 – 5391T → A in CAA87695. (PubMed:7767003)Curated
Sequence conflicti539 – 5391T → A in AAA62317. 1 PublicationCurated
Sequence conflicti539 – 5391T → A in AAA63152. 1 PublicationCurated
Sequence conflicti539 – 5391T → A in AAH37662. (PubMed:15489334)Curated
Sequence conflicti567 – 5671G → E in AAA62317. 1 PublicationCurated
Sequence conflicti567 – 5671G → E in AAA63152. 1 PublicationCurated
Sequence conflicti568 – 5692RR → E in CAA87695. (PubMed:7767003)Curated
Sequence conflicti603 – 6031S → G in AAA62317. 1 PublicationCurated
Sequence conflicti603 – 6031S → G in AAA63152. 1 PublicationCurated
Sequence conflicti624 – 6241E → R in AAA62317. 1 PublicationCurated
Sequence conflicti624 – 6241E → R in AAA63152. 1 PublicationCurated
Sequence conflicti757 – 7571Q → K in BAE41025. (PubMed:16141072)Curated
Sequence conflicti773 – 7731M → T in CAA87695. (PubMed:7767003)Curated
Sequence conflicti773 – 7731M → T in AAA62317. 1 PublicationCurated
Sequence conflicti773 – 7731M → T in AAA63152. 1 PublicationCurated
Sequence conflicti773 – 7731M → T in AAH37662. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei5 – 51G → GGECWRDGVGDRSYGTEAGG AWTRAPVTRECASHPPKHGV in isoform 2. 1 PublicationVSP_001257
Alternative sequencei232 – 2332Missing in isoform 3. 1 PublicationVSP_039778

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z47766 mRNA. Translation: CAA87695.1.
U20612 mRNA. Translation: AAA62317.1.
U20636 mRNA. Translation: AAA63152.1.
AK030298 mRNA. Translation: BAC26886.1.
AK082485 mRNA. Translation: BAC38507.1.
AK159594 mRNA. Translation: BAE35214.1.
AK169263 mRNA. Translation: BAE41025.1.
AC117577 Genomic DNA. No translation available.
BC037662 mRNA. Translation: AAH37662.1.
CCDSiCCDS37484.1. [P51944-1]
PIRiI48317.
RefSeqiNP_031660.3. NM_007634.4. [P51944-1]
UniGeneiMm.77695.

Genome annotation databases

EnsembliENSMUST00000115390; ENSMUSP00000111048; ENSMUSG00000072082. [P51944-1]
GeneIDi12449.
KEGGimmu:12449.
UCSCiuc008ave.1. mouse. [P51944-1]
uc008avg.1. mouse. [P51944-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z47766 mRNA. Translation: CAA87695.1 .
U20612 mRNA. Translation: AAA62317.1 .
U20636 mRNA. Translation: AAA63152.1 .
AK030298 mRNA. Translation: BAC26886.1 .
AK082485 mRNA. Translation: BAC38507.1 .
AK159594 mRNA. Translation: BAE35214.1 .
AK169263 mRNA. Translation: BAE41025.1 .
AC117577 Genomic DNA. No translation available.
BC037662 mRNA. Translation: AAH37662.1 .
CCDSi CCDS37484.1. [P51944-1 ]
PIRi I48317.
RefSeqi NP_031660.3. NM_007634.4. [P51944-1 ]
UniGenei Mm.77695.

3D structure databases

ProteinModelPortali P51944.
SMRi P51944. Positions 302-526.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10090.ENSMUSP00000111048.

PTM databases

PhosphoSitei P51944.

Proteomic databases

PRIDEi P51944.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000115390 ; ENSMUSP00000111048 ; ENSMUSG00000072082 . [P51944-1 ]
GeneIDi 12449.
KEGGi mmu:12449.
UCSCi uc008ave.1. mouse. [P51944-1 ]
uc008avg.1. mouse. [P51944-3 ]

Organism-specific databases

CTDi 899.
MGIi MGI:102551. Ccnf.

Phylogenomic databases

eggNOGi COG5024.
GeneTreei ENSGT00730000111208.
HOVERGENi HBG050838.
InParanoidi P51944.
KOi K10289.
OMAi KSCLQCR.
OrthoDBi EOG7WDN1V.
PhylomeDBi P51944.
TreeFami TF101006.

Miscellaneous databases

NextBioi 281282.
PROi P51944.
SOURCEi Search...

Gene expression databases

Bgeei P51944.
CleanExi MM_CCNF.
Genevestigatori P51944.

Family and domain databases

Gene3Di 1.10.472.10. 2 hits.
InterProi IPR028857. CCNF_metazoan.
IPR013763. Cyclin-like.
IPR004367. Cyclin_C-dom.
IPR006671. Cyclin_N.
IPR001810. F-box_dom.
[Graphical view ]
PANTHERi PTHR10177:SF183. PTHR10177:SF183. 1 hit.
Pfami PF02984. Cyclin_C. 1 hit.
PF00134. Cyclin_N. 1 hit.
PF00646. F-box. 1 hit.
[Graphical view ]
SMARTi SM00385. CYCLIN. 2 hits.
SM00256. FBOX. 1 hit.
[Graphical view ]
SUPFAMi SSF47954. SSF47954. 2 hits.
SSF81383. SSF81383. 1 hit.
PROSITEi PS00292. CYCLINS. 1 hit.
PS50181. FBOX. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Mouse cyclin F maps to a conserved linkage group on mouse chromosome 17."
    Obermayr F.O., Sutherland H.F., Kraus B., Frischauf A.-M.
    Mamm. Genome 6:149-150(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Expression of cyclin F at early stages of mouse embryonic brain development."
    Croci L., Stayton C.L., Bossolasco M., Bianchi E., Corradi A.M., Pardi R., Consalez G.G.
    Submitted (MAR-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Cerebellum, Kidney, Ovary and Uterus.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Strain: FVB/N.
    Tissue: Mammary tumor.
  6. "Increased levels of forkhead box M1B transcription factor in transgenic mouse hepatocytes prevent age-related proliferation defects in regenerating liver."
    Wang X., Quail E., Hung N.J., Tan Y., Ye H., Costa R.H.
    Proc. Natl. Acad. Sci. U.S.A. 98:11468-11473(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  7. "Ubiquitous expression of the forkhead box M1B transgene accelerates proliferation of distinct pulmonary cell types following lung injury."
    Kalinichenko V.V., Gusarova G.A., Tan Y., Wang I.C., Major M.L., Wang X., Yoder H.M., Costa R.H.
    J. Biol. Chem. 278:37888-37894(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  8. "Cyclin F disruption compromises placental development and affects normal cell cycle execution."
    Tetzlaff M.T., Bai C., Finegold M., Wilson J., Harper J.W., Mahon K.A., Elledge S.J.
    Mol. Cell. Biol. 24:2487-2498(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE.

Entry informationi

Entry nameiCCNF_MOUSE
AccessioniPrimary (citable) accession number: P51944
Secondary accession number(s): Q3TF73
, Q60797, Q60799, Q8BSX9, Q8C4D9, Q8CI26
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 5, 2010
Last modified: October 29, 2014
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3