Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P51944 (CCNF_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 109. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cyclin-F
Gene names
Name:Ccnf
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length777 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of CP110 during G2 phase, thereby acting as an inhibitor of centrosome reduplication By similarity.

Subunit structure

Component of the SCF(CCNF) complex consisting of CUL1, RBX1, SKP1 and CCNF. Interacts with CCNB1; interaction is required for nuclear localization of CCNB1. Interacts with CCP110; this interaction leads to CCP110 ubiquitination and degradation via the proteasome pathway By similarity.

Subcellular location

Nucleus By similarity. Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole By similarity. Note: Localization in the centrosome is rare in S phase cells and increases in G2 cells, Localizes on both the mother and daughter centrioles. Localization to centrosomes is not dependent on CP110. Also localizes to the nucleus By similarity.

Induction

Expression is activated by the FOXM1 transcription factor. Ref.6 Ref.7

Domain

The nuclear localization signals mediate the localization to the nucleus and are required for CCNB1 localization to the nucleus By similarity.

Post-translational modification

Degraded when the spindle assembly checkpoint is activated during the G2-M transition. Degradation is not dependent on the proteasome or ubiquitin and depends on the C-terminal PEST sequence By similarity.

Phosphorylated just before cells enter into mitosis By similarity.

Disruption phenotype

Death by embryonic day 10.5 (E10.5), with many developmental anomalies due in part to failures in yolk sac and chorioallantoic placentation. Heterozygous mice are normal and fertile. Ref.8

Sequence similarities

Belongs to the cyclin family. Cyclin AB subfamily.

Contains 1 cyclin N-terminal domain.

Contains 1 F-box domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P51944-1)

Also known as: Short;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P51944-2)

Also known as: Long;

The sequence of this isoform differs from the canonical sequence as follows:
     5-5: G → GGECWRDGVGDRSYGTEAGGAWTRAPVTRECASHPPKHGV
Isoform 3 (identifier: P51944-3)

The sequence of this isoform differs from the canonical sequence as follows:
     232-233: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 777777Cyclin-F
PRO_0000080464

Regions

Domain29 – 7648F-box
Domain295 – 405111Cyclin N-terminal
Region582 – 761180PEST
Motif20 – 289Nuclear localization signal 1 By similarity
Motif568 – 5747Nuclear localization signal 2 By similarity

Natural variations

Alternative sequence51G → GGECWRDGVGDRSYGTEAGG AWTRAPVTRECASHPPKHGV in isoform 2.
VSP_001257
Alternative sequence232 – 2332Missing in isoform 3.
VSP_039778

Experimental info

Sequence conflict811L → P in AAA62317. Ref.2
Sequence conflict811L → P in AAA63152. Ref.2
Sequence conflict921E → Q in CAA87695. Ref.1
Sequence conflict1321S → T in CAA87695. Ref.1
Sequence conflict2471L → H in BAC26886. Ref.3
Sequence conflict2631A → T in AAA62317. Ref.2
Sequence conflict2631A → T in AAA63152. Ref.2
Sequence conflict2901S → T in AAA62317. Ref.2
Sequence conflict2901S → T in AAA63152. Ref.2
Sequence conflict3011V → G in CAA87695. Ref.1
Sequence conflict3641T → S in AAA62317. Ref.2
Sequence conflict3641T → S in AAA63152. Ref.2
Sequence conflict4541S → A in CAA87695. Ref.1
Sequence conflict4641H → R in AAA62317. Ref.2
Sequence conflict4641H → R in AAA63152. Ref.2
Sequence conflict5081V → I in CAA87695. Ref.1
Sequence conflict5081V → I in AAA62317. Ref.2
Sequence conflict5081V → I in AAA63152. Ref.2
Sequence conflict5081V → I in AAH37662. Ref.5
Sequence conflict5271R → Q in CAA87695. Ref.1
Sequence conflict5391T → A in CAA87695. Ref.1
Sequence conflict5391T → A in AAA62317. Ref.2
Sequence conflict5391T → A in AAA63152. Ref.2
Sequence conflict5391T → A in AAH37662. Ref.5
Sequence conflict5671G → E in AAA62317. Ref.2
Sequence conflict5671G → E in AAA63152. Ref.2
Sequence conflict568 – 5692RR → E in CAA87695. Ref.1
Sequence conflict6031S → G in AAA62317. Ref.2
Sequence conflict6031S → G in AAA63152. Ref.2
Sequence conflict6241E → R in AAA62317. Ref.2
Sequence conflict6241E → R in AAA63152. Ref.2
Sequence conflict7571Q → K in BAE41025. Ref.3
Sequence conflict7731M → T in CAA87695. Ref.1
Sequence conflict7731M → T in AAA62317. Ref.2
Sequence conflict7731M → T in AAA63152. Ref.2
Sequence conflict7731M → T in AAH37662. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Short) [UniParc].

Last modified October 5, 2010. Version 2.
Checksum: 1FDA471590793DD6

FASTA77786,623
        10         20         30         40         50         60 
MGSGGVIHCR CAKCFCYPTK RRIKRRPRNL TILSLPEDVL FHILKWLSVG DILAVRAVHS 

        70         80         90        100        110        120 
HLKYLVDNHA SVWASASFQE LWPSPQNLKL FERAAEKGNF EAAVKLGIAY LYNEGLSVSD 

       130        140        150        160        170        180 
EACAEVNGLK ASRFFSMAER LNTGSEPFIW LFIRPPWSVS GSCCKAVVHD SLRAECQLQR 

       190        200        210        220        230        240 
SHKASILHCL GRVLNLFEDE EKRKQARSLL EESSRQGCLI SSYLLWESDR KVDMSDPGRC 

       250        260        270        280        290        300 
LHSFRKLRDY AAKGCWEAQL ALAKACAGGS QLGLEGKACS ESVCQLFQAS QAVNKQQIFS 

       310        320        330        340        350        360 
VQKGLSDTMR YILIDWLVEV ATMKDFTSLC LHLTVECVDR YLRRRLVPRY KLQLLGIACM 

       370        380        390        400        410        420 
VICTRFISKE ILTIREAVWL TDNTYKYEDL VRVMGEIISA LEGKIRIPTV VDYKEVLLTL 

       430        440        450        460        470        480 
VPVAPRTQHL CSFLCELTLL HTSLSIYAPA RLASAALLLA RLMHGQTQPW TTHLWDLTGF 

       490        500        510        520        530        540 
SYSDLVPCVL SLHKKCFHDD APKDYRQVSL TAVKQRFEDK CYEEISREEV LSYADLCSTI 

       550        560        570        580        590        600 
GVKQESPEPP SFPSSGEIHT FLSSPSGRRS KRKRENSLQE DRGSFVTTPT AELSNQEETL 

       610        620        630        640        650        660 
LGSLLDWSLE CCSGYEGDQE SEGEKEGDVT APSRLLDVTV VYLNPEEHCC QESSDEEAWP 

       670        680        690        700        710        720 
EDKIHPAPGT QAPPASAPRP LLCNRGDRAK DITTSGYSSV SSSSPISSLD GGMGGSPQST 

       730        740        750        760        770 
SVLSVGSHSS TKPCHHQAKK SCLQCRPPNS PESGVHQQPV KRQNLSVHSD KDMHLAS 

« Hide

Isoform 2 (Long) [UniParc].

Checksum: C6B4284932DDD381
Show »

FASTA81690,759
Isoform 3 [UniParc].

Checksum: 3AFF206EED11CF53
Show »

FASTA77586,409

References

« Hide 'large scale' references
[1]"Mouse cyclin F maps to a conserved linkage group on mouse chromosome 17."
Obermayr F.O., Sutherland H.F., Kraus B., Frischauf A.-M.
Mamm. Genome 6:149-150(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Expression of cyclin F at early stages of mouse embryonic brain development."
Croci L., Stayton C.L., Bossolasco M., Bianchi E., Corradi A.M., Pardi R., Consalez G.G.
Submitted (MAR-1995) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6J.
Tissue: Cerebellum, Kidney, Ovary and Uterus.
[4]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Strain: FVB/N.
Tissue: Mammary tumor.
[6]"Increased levels of forkhead box M1B transcription factor in transgenic mouse hepatocytes prevent age-related proliferation defects in regenerating liver."
Wang X., Quail E., Hung N.J., Tan Y., Ye H., Costa R.H.
Proc. Natl. Acad. Sci. U.S.A. 98:11468-11473(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: INDUCTION.
[7]"Ubiquitous expression of the forkhead box M1B transgene accelerates proliferation of distinct pulmonary cell types following lung injury."
Kalinichenko V.V., Gusarova G.A., Tan Y., Wang I.C., Major M.L., Wang X., Yoder H.M., Costa R.H.
J. Biol. Chem. 278:37888-37894(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: INDUCTION.
[8]"Cyclin F disruption compromises placental development and affects normal cell cycle execution."
Tetzlaff M.T., Bai C., Finegold M., Wilson J., Harper J.W., Mahon K.A., Elledge S.J.
Mol. Cell. Biol. 24:2487-2498(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: DISRUPTION PHENOTYPE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Z47766 mRNA. Translation: CAA87695.1.
U20612 mRNA. Translation: AAA62317.1.
U20636 mRNA. Translation: AAA63152.1.
AK030298 mRNA. Translation: BAC26886.1.
AK082485 mRNA. Translation: BAC38507.1.
AK159594 mRNA. Translation: BAE35214.1.
AK169263 mRNA. Translation: BAE41025.1.
AC117577 Genomic DNA. No translation available.
BC037662 mRNA. Translation: AAH37662.1.
CCDSCCDS37484.1. [P51944-1]
PIRI48317.
RefSeqNP_031660.3. NM_007634.4. [P51944-1]
UniGeneMm.77695.

3D structure databases

ProteinModelPortalP51944.
SMRP51944. Positions 302-526.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING10090.ENSMUSP00000111048.

PTM databases

PhosphoSiteP51944.

Proteomic databases

PRIDEP51944.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000115390; ENSMUSP00000111048; ENSMUSG00000072082. [P51944-1]
GeneID12449.
KEGGmmu:12449.
UCSCuc008ave.1. mouse. [P51944-1]
uc008avg.1. mouse. [P51944-3]

Organism-specific databases

CTD899.
MGIMGI:102551. Ccnf.

Phylogenomic databases

eggNOGCOG5024.
GeneTreeENSGT00730000111208.
HOVERGENHBG050838.
KOK10289.
OMAKSCLQCR.
OrthoDBEOG7WDN1V.
PhylomeDBP51944.
TreeFamTF101006.

Gene expression databases

BgeeP51944.
CleanExMM_CCNF.
GenevestigatorP51944.

Family and domain databases

Gene3D1.10.472.10. 2 hits.
InterProIPR028857. CCNF_metazoan.
IPR013763. Cyclin-like.
IPR004367. Cyclin_C-dom.
IPR006671. Cyclin_N.
IPR001810. F-box_dom.
[Graphical view]
PANTHERPTHR10177:SF183. PTHR10177:SF183. 1 hit.
PfamPF02984. Cyclin_C. 1 hit.
PF00134. Cyclin_N. 1 hit.
PF00646. F-box. 1 hit.
[Graphical view]
SMARTSM00385. CYCLIN. 2 hits.
SM00256. FBOX. 1 hit.
[Graphical view]
SUPFAMSSF47954. SSF47954. 2 hits.
SSF81383. SSF81383. 1 hit.
PROSITEPS00292. CYCLINS. 1 hit.
PS50181. FBOX. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio281282.
PROP51944.
SOURCESearch...

Entry information

Entry nameCCNF_MOUSE
AccessionPrimary (citable) accession number: P51944
Secondary accession number(s): Q3TF73 expand/collapse secondary AC list , Q60797, Q60799, Q8BSX9, Q8C4D9, Q8CI26
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 5, 2010
Last modified: July 9, 2014
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot