Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P51944

- CCNF_MOUSE

UniProt

P51944 - CCNF_MOUSE

Protein

Cyclin-F

Gene

Ccnf

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 111 (01 Oct 2014)
      Sequence version 2 (05 Oct 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of CP110 during G2 phase, thereby acting as an inhibitor of centrosome reduplication.By similarity

    GO - Biological processi

    1. mitotic nuclear division Source: UniProtKB-KW
    2. negative regulation of centrosome duplication Source: UniProtKB
    3. placenta development Source: MGI
    4. protein ubiquitination Source: UniProtKB
    5. re-entry into mitotic cell cycle Source: MGI
    6. SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Source: UniProtKB

    Keywords - Molecular functioni

    Cyclin

    Keywords - Biological processi

    Cell cycle, Cell division, Mitosis, Ubl conjugation pathway

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclin-F
    Gene namesi
    Name:Ccnf
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 17

    Organism-specific databases

    MGIiMGI:102551. Ccnf.

    Subcellular locationi

    Nucleus By similarity. Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole By similarity
    Note: Localization in the centrosome is rare in S phase cells and increases in G2 cells, Localizes on both the mother and daughter centrioles. Localization to centrosomes is not dependent on CP110. Also localizes to the nucleus By similarity.By similarity

    GO - Cellular componenti

    1. centriole Source: UniProtKB
    2. nucleus Source: UniProtKB
    3. SCF ubiquitin ligase complex Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Nucleus

    Pathology & Biotechi

    Disruption phenotypei

    Death by embryonic day 10.5 (E10.5), with many developmental anomalies due in part to failures in yolk sac and chorioallantoic placentation. Heterozygous mice are normal and fertile.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 777777Cyclin-FPRO_0000080464Add
    BLAST

    Post-translational modificationi

    Degraded when the spindle assembly checkpoint is activated during the G2-M transition. Degradation is not dependent on the proteasome or ubiquitin and depends on the C-terminal PEST sequence By similarity.By similarity
    Phosphorylated just before cells enter into mitosis.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PRIDEiP51944.

    PTM databases

    PhosphoSiteiP51944.

    Expressioni

    Inductioni

    Expression is activated by the FOXM1 transcription factor.2 Publications

    Gene expression databases

    BgeeiP51944.
    CleanExiMM_CCNF.
    GenevestigatoriP51944.

    Interactioni

    Subunit structurei

    Component of the SCF(CCNF) complex consisting of CUL1, RBX1, SKP1 and CCNF. Interacts with CCNB1; interaction is required for nuclear localization of CCNB1. Interacts with CCP110; this interaction leads to CCP110 ubiquitination and degradation via the proteasome pathway By similarity.By similarity

    Protein-protein interaction databases

    STRINGi10090.ENSMUSP00000111048.

    Structurei

    3D structure databases

    ProteinModelPortaliP51944.
    SMRiP51944. Positions 302-526.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini29 – 7648F-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini295 – 405111Cyclin N-terminalAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni582 – 761180PESTAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi20 – 289Nuclear localization signal 1By similarity
    Motifi568 – 5747Nuclear localization signal 2By similarity

    Domaini

    The nuclear localization signals mediate the localization to the nucleus and are required for CCNB1 localization to the nucleus.By similarity

    Sequence similaritiesi

    Belongs to the cyclin family. Cyclin AB subfamily.Curated
    Contains 1 cyclin N-terminal domain.Curated
    Contains 1 F-box domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG5024.
    GeneTreeiENSGT00730000111208.
    HOVERGENiHBG050838.
    KOiK10289.
    OMAiKSCLQCR.
    OrthoDBiEOG7WDN1V.
    PhylomeDBiP51944.
    TreeFamiTF101006.

    Family and domain databases

    Gene3Di1.10.472.10. 2 hits.
    InterProiIPR028857. CCNF_metazoan.
    IPR013763. Cyclin-like.
    IPR004367. Cyclin_C-dom.
    IPR006671. Cyclin_N.
    IPR001810. F-box_dom.
    [Graphical view]
    PANTHERiPTHR10177:SF183. PTHR10177:SF183. 1 hit.
    PfamiPF02984. Cyclin_C. 1 hit.
    PF00134. Cyclin_N. 1 hit.
    PF00646. F-box. 1 hit.
    [Graphical view]
    SMARTiSM00385. CYCLIN. 2 hits.
    SM00256. FBOX. 1 hit.
    [Graphical view]
    SUPFAMiSSF47954. SSF47954. 2 hits.
    SSF81383. SSF81383. 1 hit.
    PROSITEiPS00292. CYCLINS. 1 hit.
    PS50181. FBOX. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P51944-1) [UniParc]FASTAAdd to Basket

    Also known as: Short

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSGGVIHCR CAKCFCYPTK RRIKRRPRNL TILSLPEDVL FHILKWLSVG    50
    DILAVRAVHS HLKYLVDNHA SVWASASFQE LWPSPQNLKL FERAAEKGNF 100
    EAAVKLGIAY LYNEGLSVSD EACAEVNGLK ASRFFSMAER LNTGSEPFIW 150
    LFIRPPWSVS GSCCKAVVHD SLRAECQLQR SHKASILHCL GRVLNLFEDE 200
    EKRKQARSLL EESSRQGCLI SSYLLWESDR KVDMSDPGRC LHSFRKLRDY 250
    AAKGCWEAQL ALAKACAGGS QLGLEGKACS ESVCQLFQAS QAVNKQQIFS 300
    VQKGLSDTMR YILIDWLVEV ATMKDFTSLC LHLTVECVDR YLRRRLVPRY 350
    KLQLLGIACM VICTRFISKE ILTIREAVWL TDNTYKYEDL VRVMGEIISA 400
    LEGKIRIPTV VDYKEVLLTL VPVAPRTQHL CSFLCELTLL HTSLSIYAPA 450
    RLASAALLLA RLMHGQTQPW TTHLWDLTGF SYSDLVPCVL SLHKKCFHDD 500
    APKDYRQVSL TAVKQRFEDK CYEEISREEV LSYADLCSTI GVKQESPEPP 550
    SFPSSGEIHT FLSSPSGRRS KRKRENSLQE DRGSFVTTPT AELSNQEETL 600
    LGSLLDWSLE CCSGYEGDQE SEGEKEGDVT APSRLLDVTV VYLNPEEHCC 650
    QESSDEEAWP EDKIHPAPGT QAPPASAPRP LLCNRGDRAK DITTSGYSSV 700
    SSSSPISSLD GGMGGSPQST SVLSVGSHSS TKPCHHQAKK SCLQCRPPNS 750
    PESGVHQQPV KRQNLSVHSD KDMHLAS 777
    Length:777
    Mass (Da):86,623
    Last modified:October 5, 2010 - v2
    Checksum:i1FDA471590793DD6
    GO
    Isoform 2 (identifier: P51944-2) [UniParc]FASTAAdd to Basket

    Also known as: Long

    The sequence of this isoform differs from the canonical sequence as follows:
         5-5: G → GGECWRDGVGDRSYGTEAGGAWTRAPVTRECASHPPKHGV

    Show »
    Length:816
    Mass (Da):90,759
    Checksum:iC6B4284932DDD381
    GO
    Isoform 3 (identifier: P51944-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         232-233: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:775
    Mass (Da):86,409
    Checksum:i3AFF206EED11CF53
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti81 – 811L → P in AAA62317. 1 PublicationCurated
    Sequence conflicti81 – 811L → P in AAA63152. 1 PublicationCurated
    Sequence conflicti92 – 921E → Q in CAA87695. (PubMed:7767003)Curated
    Sequence conflicti132 – 1321S → T in CAA87695. (PubMed:7767003)Curated
    Sequence conflicti247 – 2471L → H in BAC26886. (PubMed:16141072)Curated
    Sequence conflicti263 – 2631A → T in AAA62317. 1 PublicationCurated
    Sequence conflicti263 – 2631A → T in AAA63152. 1 PublicationCurated
    Sequence conflicti290 – 2901S → T in AAA62317. 1 PublicationCurated
    Sequence conflicti290 – 2901S → T in AAA63152. 1 PublicationCurated
    Sequence conflicti301 – 3011V → G in CAA87695. (PubMed:7767003)Curated
    Sequence conflicti364 – 3641T → S in AAA62317. 1 PublicationCurated
    Sequence conflicti364 – 3641T → S in AAA63152. 1 PublicationCurated
    Sequence conflicti454 – 4541S → A in CAA87695. (PubMed:7767003)Curated
    Sequence conflicti464 – 4641H → R in AAA62317. 1 PublicationCurated
    Sequence conflicti464 – 4641H → R in AAA63152. 1 PublicationCurated
    Sequence conflicti508 – 5081V → I in CAA87695. (PubMed:7767003)Curated
    Sequence conflicti508 – 5081V → I in AAA62317. 1 PublicationCurated
    Sequence conflicti508 – 5081V → I in AAA63152. 1 PublicationCurated
    Sequence conflicti508 – 5081V → I in AAH37662. (PubMed:15489334)Curated
    Sequence conflicti527 – 5271R → Q in CAA87695. (PubMed:7767003)Curated
    Sequence conflicti539 – 5391T → A in CAA87695. (PubMed:7767003)Curated
    Sequence conflicti539 – 5391T → A in AAA62317. 1 PublicationCurated
    Sequence conflicti539 – 5391T → A in AAA63152. 1 PublicationCurated
    Sequence conflicti539 – 5391T → A in AAH37662. (PubMed:15489334)Curated
    Sequence conflicti567 – 5671G → E in AAA62317. 1 PublicationCurated
    Sequence conflicti567 – 5671G → E in AAA63152. 1 PublicationCurated
    Sequence conflicti568 – 5692RR → E in CAA87695. (PubMed:7767003)Curated
    Sequence conflicti603 – 6031S → G in AAA62317. 1 PublicationCurated
    Sequence conflicti603 – 6031S → G in AAA63152. 1 PublicationCurated
    Sequence conflicti624 – 6241E → R in AAA62317. 1 PublicationCurated
    Sequence conflicti624 – 6241E → R in AAA63152. 1 PublicationCurated
    Sequence conflicti757 – 7571Q → K in BAE41025. (PubMed:16141072)Curated
    Sequence conflicti773 – 7731M → T in CAA87695. (PubMed:7767003)Curated
    Sequence conflicti773 – 7731M → T in AAA62317. 1 PublicationCurated
    Sequence conflicti773 – 7731M → T in AAA63152. 1 PublicationCurated
    Sequence conflicti773 – 7731M → T in AAH37662. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei5 – 51G → GGECWRDGVGDRSYGTEAGG AWTRAPVTRECASHPPKHGV in isoform 2. 1 PublicationVSP_001257
    Alternative sequencei232 – 2332Missing in isoform 3. 1 PublicationVSP_039778

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z47766 mRNA. Translation: CAA87695.1.
    U20612 mRNA. Translation: AAA62317.1.
    U20636 mRNA. Translation: AAA63152.1.
    AK030298 mRNA. Translation: BAC26886.1.
    AK082485 mRNA. Translation: BAC38507.1.
    AK159594 mRNA. Translation: BAE35214.1.
    AK169263 mRNA. Translation: BAE41025.1.
    AC117577 Genomic DNA. No translation available.
    BC037662 mRNA. Translation: AAH37662.1.
    CCDSiCCDS37484.1. [P51944-1]
    PIRiI48317.
    RefSeqiNP_031660.3. NM_007634.4. [P51944-1]
    UniGeneiMm.77695.

    Genome annotation databases

    EnsembliENSMUST00000115390; ENSMUSP00000111048; ENSMUSG00000072082. [P51944-1]
    GeneIDi12449.
    KEGGimmu:12449.
    UCSCiuc008ave.1. mouse. [P51944-1]
    uc008avg.1. mouse. [P51944-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z47766 mRNA. Translation: CAA87695.1 .
    U20612 mRNA. Translation: AAA62317.1 .
    U20636 mRNA. Translation: AAA63152.1 .
    AK030298 mRNA. Translation: BAC26886.1 .
    AK082485 mRNA. Translation: BAC38507.1 .
    AK159594 mRNA. Translation: BAE35214.1 .
    AK169263 mRNA. Translation: BAE41025.1 .
    AC117577 Genomic DNA. No translation available.
    BC037662 mRNA. Translation: AAH37662.1 .
    CCDSi CCDS37484.1. [P51944-1 ]
    PIRi I48317.
    RefSeqi NP_031660.3. NM_007634.4. [P51944-1 ]
    UniGenei Mm.77695.

    3D structure databases

    ProteinModelPortali P51944.
    SMRi P51944. Positions 302-526.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10090.ENSMUSP00000111048.

    PTM databases

    PhosphoSitei P51944.

    Proteomic databases

    PRIDEi P51944.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000115390 ; ENSMUSP00000111048 ; ENSMUSG00000072082 . [P51944-1 ]
    GeneIDi 12449.
    KEGGi mmu:12449.
    UCSCi uc008ave.1. mouse. [P51944-1 ]
    uc008avg.1. mouse. [P51944-3 ]

    Organism-specific databases

    CTDi 899.
    MGIi MGI:102551. Ccnf.

    Phylogenomic databases

    eggNOGi COG5024.
    GeneTreei ENSGT00730000111208.
    HOVERGENi HBG050838.
    KOi K10289.
    OMAi KSCLQCR.
    OrthoDBi EOG7WDN1V.
    PhylomeDBi P51944.
    TreeFami TF101006.

    Miscellaneous databases

    NextBioi 281282.
    PROi P51944.
    SOURCEi Search...

    Gene expression databases

    Bgeei P51944.
    CleanExi MM_CCNF.
    Genevestigatori P51944.

    Family and domain databases

    Gene3Di 1.10.472.10. 2 hits.
    InterProi IPR028857. CCNF_metazoan.
    IPR013763. Cyclin-like.
    IPR004367. Cyclin_C-dom.
    IPR006671. Cyclin_N.
    IPR001810. F-box_dom.
    [Graphical view ]
    PANTHERi PTHR10177:SF183. PTHR10177:SF183. 1 hit.
    Pfami PF02984. Cyclin_C. 1 hit.
    PF00134. Cyclin_N. 1 hit.
    PF00646. F-box. 1 hit.
    [Graphical view ]
    SMARTi SM00385. CYCLIN. 2 hits.
    SM00256. FBOX. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47954. SSF47954. 2 hits.
    SSF81383. SSF81383. 1 hit.
    PROSITEi PS00292. CYCLINS. 1 hit.
    PS50181. FBOX. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Mouse cyclin F maps to a conserved linkage group on mouse chromosome 17."
      Obermayr F.O., Sutherland H.F., Kraus B., Frischauf A.-M.
      Mamm. Genome 6:149-150(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Expression of cyclin F at early stages of mouse embryonic brain development."
      Croci L., Stayton C.L., Bossolasco M., Bianchi E., Corradi A.M., Pardi R., Consalez G.G.
      Submitted (MAR-1995) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Cerebellum, Kidney, Ovary and Uterus.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Strain: FVB/N.
      Tissue: Mammary tumor.
    6. "Increased levels of forkhead box M1B transcription factor in transgenic mouse hepatocytes prevent age-related proliferation defects in regenerating liver."
      Wang X., Quail E., Hung N.J., Tan Y., Ye H., Costa R.H.
      Proc. Natl. Acad. Sci. U.S.A. 98:11468-11473(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.
    7. "Ubiquitous expression of the forkhead box M1B transgene accelerates proliferation of distinct pulmonary cell types following lung injury."
      Kalinichenko V.V., Gusarova G.A., Tan Y., Wang I.C., Major M.L., Wang X., Yoder H.M., Costa R.H.
      J. Biol. Chem. 278:37888-37894(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.
    8. "Cyclin F disruption compromises placental development and affects normal cell cycle execution."
      Tetzlaff M.T., Bai C., Finegold M., Wilson J., Harper J.W., Mahon K.A., Elledge S.J.
      Mol. Cell. Biol. 24:2487-2498(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISRUPTION PHENOTYPE.

    Entry informationi

    Entry nameiCCNF_MOUSE
    AccessioniPrimary (citable) accession number: P51944
    Secondary accession number(s): Q3TF73
    , Q60797, Q60799, Q8BSX9, Q8C4D9, Q8CI26
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: October 5, 2010
    Last modified: October 1, 2014
    This is version 111 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3