Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hepatoma-derived growth factor

Gene

HDGF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei19 – 191HeparinCurated
Binding sitei21 – 211HeparinCurated
Binding sitei72 – 721HeparinCurated
Binding sitei75 – 751HeparinCurated
Binding sitei79 – 791HeparinCurated
Binding sitei80 – 801HeparinCurated

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • heparin binding Source: ProtInc
  • nucleotide binding Source: UniProtKB-KW
  • poly(A) RNA binding Source: UniProtKB
  • RNA polymerase II transcription corepressor activity Source: BHF-UCL
  • transcription corepressor binding Source: BHF-UCL

GO - Biological processi

  • cell proliferation Source: ProtInc
  • IRE1-mediated unfolded protein response Source: Reactome
  • negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  • signal transduction Source: ProtInc
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Growth factor, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Heparin-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-381038. XBP1(S) activates chaperone genes.

Names & Taxonomyi

Protein namesi
Recommended name:
Hepatoma-derived growth factor
Short name:
HDGF
Alternative name(s):
High mobility group protein 1-like 2
Short name:
HMG-1L2
Gene namesi
Name:HDGF
Synonyms:HMG1L2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:4856. HDGF.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: ProtInc
  • extracellular space Source: BHF-UCL
  • nucleoplasm Source: HPA
  • transcriptional repressor complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29234.

Polymorphism and mutation databases

BioMutaiHDGF.
DMDMi1708157.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 240240Hepatoma-derived growth factorPRO_0000191700Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei44 – 441N6-acetyllysineCombined sources
Cross-linki80 – 80Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linki80 – 80Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei132 – 1321PhosphoserineCombined sources
Modified residuei133 – 1331PhosphoserineCombined sources
Modified residuei165 – 1651PhosphoserineCombined sources
Modified residuei184 – 1841PhosphothreonineCombined sources
Modified residuei199 – 1991PhosphoserineBy similarity
Modified residuei200 – 2001PhosphothreonineCombined sources
Modified residuei202 – 2021PhosphoserineCombined sources
Modified residuei206 – 2061PhosphoserineCombined sources
Modified residuei239 – 2391PhosphoserineCombined sources

Post-translational modificationi

Sumoylated with SUMO1. Sumoylation prevents binding to chromatin.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP51858.
MaxQBiP51858.
PaxDbiP51858.
PeptideAtlasiP51858.
PRIDEiP51858.
TopDownProteomicsiP51858-1. [P51858-1]
P51858-2. [P51858-2]

PTM databases

iPTMnetiP51858.
PhosphoSiteiP51858.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiENSG00000143321.
CleanExiHS_HDGF.
GenevisibleiP51858. HS.

Organism-specific databases

HPAiCAB026035.
HPA048728.
HPA053422.

Interactioni

Subunit structurei

Monomer, and domain-swapped homodimer.1 Publication

GO - Molecular functioni

  • transcription corepressor binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi109318. 213 interactions.
IntActiP51858. 112 interactions.
MINTiMINT-5003673.
STRINGi9606.ENSP00000357189.

Structurei

Secondary structure

1
240
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi7 – 93Combined sources
Beta strandi15 – 206Combined sources
Beta strandi23 – 319Combined sources
Beta strandi35 – 384Combined sources
Beta strandi45 – 495Combined sources
Turni50 – 534Combined sources
Beta strandi54 – 585Combined sources
Helixi60 – 623Combined sources
Helixi66 – 727Combined sources
Helixi80 – 9011Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1RI0NMR-A1-100[»]
2NLUNMR-A/B1-100[»]
ProteinModelPortaliP51858.
SMRiP51858. Positions 1-100.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP51858.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini12 – 6958PWWPPROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi75 – 806Nuclear localization signal1 Publication
Motifi155 – 17016Bipartite nuclear localization signalAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi110 – 230121Glu-richAdd
BLAST

Domaini

The PWWP domain harbors the heparin-binding sites and is responsible for DNA-binding, while the C-terminal region is essentially unstructured.

Sequence similaritiesi

Belongs to the HDGF family.Curated
Contains 1 PWWP domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IMJ5. Eukaryota.
ENOG4111IFT. LUCA.
GeneTreeiENSGT00530000063013.
HOGENOMiHOG000112874.
HOVERGENiHBG010574.
InParanoidiP51858.
KOiK16641.
OMAiGEKKGNT.
OrthoDBiEOG091G045X.
PhylomeDBiP51858.
TreeFamiTF105385.

Family and domain databases

InterProiIPR000313. PWWP_dom.
[Graphical view]
PfamiPF00855. PWWP. 1 hit.
[Graphical view]
SMARTiSM00293. PWWP. 1 hit.
[Graphical view]
PROSITEiPS50812. PWWP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P51858-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRSNRQKEY KCGDLVFAKM KGYPHWPARI DEMPEAAVKS TANKYQVFFF
60 70 80 90 100
GTHETAFLGP KDLFPYEESK EKFGKPNKRK GFSEGLWEIE NNPTVKASGY
110 120 130 140 150
QSSQKKSCVE EPEPEPEAAE GDGDKKGNAE GSSDEEGKLV IDEPAKEKNE
160 170 180 190 200
KGALKRRAGD LLEDSPKRPK EAENPEGEEK EAATLEVERP LPMEVEKNST
210 220 230 240
PSEPGSGRGP PQEEEEEEDE EEEATKEDAE APGIRDHESL
Length:240
Mass (Da):26,788
Last modified:October 1, 1996 - v1
Checksum:iDD60D9203BDD4B34
GO
Isoform 2 (identifier: P51858-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MSRSNRQKEYKCGDLVFAKMKGYPHWPAR → MEQRAGGNRVQTSTLNCAGAAV

Note: No experimental confirmation available.
Show »
Length:233
Mass (Da):25,538
Checksum:i629AFF8900895888
GO
Isoform 3 (identifier: P51858-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MSRSNRQKEYKCGDLVFAKMKGYPHWPAR → MHPEGGQFVPQLLGHLLATKLKRFLLSKGGRRAQIPDVSRATPHT

Note: Gene prediction based on EST data.
Show »
Length:256
Mass (Da):28,264
Checksum:iD9D2BC3056553CF9
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti206 – 2061S → P in BAG53283 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti201 – 2011P → L.1 Publication
Corresponds to variant rs4399146 [ dbSNP | Ensembl ].
VAR_061209

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2929MSRSN…HWPAR → MEQRAGGNRVQTSTLNCAGA AV in isoform 2. 1 PublicationVSP_045620Add
BLAST
Alternative sequencei1 – 2929MSRSN…HWPAR → MHPEGGQFVPQLLGHLLATK LKRFLLSKGGRRAQIPDVSR ATPHT in isoform 3. CuratedVSP_047328Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D16431 mRNA. Translation: BAA03903.1.
AK096411 mRNA. Translation: BAG53283.1.
AL590666 Genomic DNA. No translation available.
CH471121 Genomic DNA. Translation: EAW52910.1.
CH471121 Genomic DNA. Translation: EAW52911.1.
CH471121 Genomic DNA. Translation: EAW52912.1.
BC018991 mRNA. Translation: AAH18991.1.
CCDSiCCDS1156.1. [P51858-1]
CCDS44247.1. [P51858-3]
CCDS44248.1. [P51858-2]
PIRiA55055.
RefSeqiNP_001119522.1. NM_001126050.1. [P51858-3]
NP_001119523.1. NM_001126051.1. [P51858-2]
NP_001306115.1. NM_001319186.1.
NP_001306116.1. NM_001319187.1.
NP_001306117.1. NM_001319188.1.
NP_004485.1. NM_004494.2. [P51858-1]
UniGeneiHs.743948.

Genome annotation databases

EnsembliENST00000357325; ENSP00000349878; ENSG00000143321. [P51858-1]
ENST00000368206; ENSP00000357189; ENSG00000143321. [P51858-3]
ENST00000368209; ENSP00000357192; ENSG00000143321. [P51858-2]
ENST00000537739; ENSP00000443120; ENSG00000143321. [P51858-1]
GeneIDi3068.
KEGGihsa:3068.
UCSCiuc001fpy.5. human. [P51858-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D16431 mRNA. Translation: BAA03903.1.
AK096411 mRNA. Translation: BAG53283.1.
AL590666 Genomic DNA. No translation available.
CH471121 Genomic DNA. Translation: EAW52910.1.
CH471121 Genomic DNA. Translation: EAW52911.1.
CH471121 Genomic DNA. Translation: EAW52912.1.
BC018991 mRNA. Translation: AAH18991.1.
CCDSiCCDS1156.1. [P51858-1]
CCDS44247.1. [P51858-3]
CCDS44248.1. [P51858-2]
PIRiA55055.
RefSeqiNP_001119522.1. NM_001126050.1. [P51858-3]
NP_001119523.1. NM_001126051.1. [P51858-2]
NP_001306115.1. NM_001319186.1.
NP_001306116.1. NM_001319187.1.
NP_001306117.1. NM_001319188.1.
NP_004485.1. NM_004494.2. [P51858-1]
UniGeneiHs.743948.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1RI0NMR-A1-100[»]
2NLUNMR-A/B1-100[»]
ProteinModelPortaliP51858.
SMRiP51858. Positions 1-100.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109318. 213 interactions.
IntActiP51858. 112 interactions.
MINTiMINT-5003673.
STRINGi9606.ENSP00000357189.

PTM databases

iPTMnetiP51858.
PhosphoSiteiP51858.

Polymorphism and mutation databases

BioMutaiHDGF.
DMDMi1708157.

Proteomic databases

EPDiP51858.
MaxQBiP51858.
PaxDbiP51858.
PeptideAtlasiP51858.
PRIDEiP51858.
TopDownProteomicsiP51858-1. [P51858-1]
P51858-2. [P51858-2]

Protocols and materials databases

DNASUi3068.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000357325; ENSP00000349878; ENSG00000143321. [P51858-1]
ENST00000368206; ENSP00000357189; ENSG00000143321. [P51858-3]
ENST00000368209; ENSP00000357192; ENSG00000143321. [P51858-2]
ENST00000537739; ENSP00000443120; ENSG00000143321. [P51858-1]
GeneIDi3068.
KEGGihsa:3068.
UCSCiuc001fpy.5. human. [P51858-1]

Organism-specific databases

CTDi3068.
GeneCardsiHDGF.
HGNCiHGNC:4856. HDGF.
HPAiCAB026035.
HPA048728.
HPA053422.
MIMi600339. gene.
neXtProtiNX_P51858.
PharmGKBiPA29234.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMJ5. Eukaryota.
ENOG4111IFT. LUCA.
GeneTreeiENSGT00530000063013.
HOGENOMiHOG000112874.
HOVERGENiHBG010574.
InParanoidiP51858.
KOiK16641.
OMAiGEKKGNT.
OrthoDBiEOG091G045X.
PhylomeDBiP51858.
TreeFamiTF105385.

Enzyme and pathway databases

ReactomeiR-HSA-381038. XBP1(S) activates chaperone genes.

Miscellaneous databases

ChiTaRSiHDGF. human.
EvolutionaryTraceiP51858.
GeneWikiiHepatoma-derived_growth_factor.
GenomeRNAii3068.
PROiP51858.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143321.
CleanExiHS_HDGF.
GenevisibleiP51858. HS.

Family and domain databases

InterProiIPR000313. PWWP_dom.
[Graphical view]
PfamiPF00855. PWWP. 1 hit.
[Graphical view]
SMARTiSM00293. PWWP. 1 hit.
[Graphical view]
PROSITEiPS50812. PWWP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHDGF_HUMAN
AccessioniPrimary (citable) accession number: P51858
Secondary accession number(s): B3KU21
, D3DVC9, Q5SZ07, Q5SZ08, Q5SZ09
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: September 7, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.