Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hepatoma-derived growth factor

Gene

HDGF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei19HeparinCurated1
Binding sitei21HeparinCurated1
Binding sitei72HeparinCurated1
Binding sitei75HeparinCurated1
Binding sitei79HeparinCurated1
Binding sitei80HeparinCurated1

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • growth factor activity Source: UniProtKB-KW
  • heparin binding Source: ProtInc
  • nucleotide binding Source: UniProtKB-KW
  • RNA binding Source: UniProtKB
  • RNA polymerase II transcription corepressor activity Source: BHF-UCL
  • transcription corepressor binding Source: BHF-UCL

GO - Biological processi

  • cell proliferation Source: ProtInc
  • IRE1-mediated unfolded protein response Source: Reactome
  • negative regulation of transcription by RNA polymerase II Source: BHF-UCL
  • signal transduction Source: ProtInc
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionDNA-binding, Growth factor, Heparin-binding, Repressor
Biological processTranscription, Transcription regulation
LigandNucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-381038 XBP1(S) activates chaperone genes

Names & Taxonomyi

Protein namesi
Recommended name:
Hepatoma-derived growth factor
Short name:
HDGF
Alternative name(s):
High mobility group protein 1-like 2
Short name:
HMG-1L2
Gene namesi
Name:HDGF
Synonyms:HMG1L2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000143321.18
HGNCiHGNC:4856 HDGF
MIMi600339 gene
neXtProtiNX_P51858

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi3068
OpenTargetsiENSG00000143321
PharmGKBiPA29234

Polymorphism and mutation databases

BioMutaiHDGF
DMDMi1708157

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001917001 – 240Hepatoma-derived growth factorAdd BLAST240

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei44N6-acetyllysineCombined sources1
Cross-linki80Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linki80Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei132PhosphoserineCombined sources1
Modified residuei133PhosphoserineCombined sources1
Modified residuei165PhosphoserineCombined sources1
Modified residuei184PhosphothreonineCombined sources1
Modified residuei199PhosphoserineBy similarity1
Modified residuei200PhosphothreonineCombined sources1
Modified residuei202PhosphoserineCombined sources1
Modified residuei206PhosphoserineCombined sources1
Modified residuei239PhosphoserineCombined sources1

Post-translational modificationi

Sumoylated with SUMO1. Sumoylation prevents binding to chromatin.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP51858
MaxQBiP51858
PaxDbiP51858
PeptideAtlasiP51858
PRIDEiP51858
TopDownProteomicsiP51858-1 [P51858-1]
P51858-2 [P51858-2]

PTM databases

iPTMnetiP51858
PhosphoSitePlusiP51858

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiENSG00000143321
CleanExiHS_HDGF
GenevisibleiP51858 HS

Organism-specific databases

HPAiCAB026035
HPA048728
HPA053422

Interactioni

Subunit structurei

Monomer, and domain-swapped homodimer.1 Publication

GO - Molecular functioni

  • growth factor activity Source: UniProtKB-KW
  • transcription corepressor binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi109318, 215 interactors
CORUMiP51858
IntActiP51858, 114 interactors
STRINGi9606.ENSP00000357189

Structurei

Secondary structure

1240
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi7 – 9Combined sources3
Beta strandi15 – 20Combined sources6
Beta strandi23 – 31Combined sources9
Beta strandi35 – 38Combined sources4
Beta strandi45 – 49Combined sources5
Turni50 – 53Combined sources4
Beta strandi54 – 58Combined sources5
Helixi60 – 62Combined sources3
Helixi66 – 72Combined sources7
Helixi80 – 90Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RI0NMR-A1-100[»]
2NLUNMR-A/B1-100[»]
ProteinModelPortaliP51858
SMRiP51858
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP51858

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini12 – 69PWWPPROSITE-ProRule annotationAdd BLAST58

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi75 – 80Nuclear localization signal1 Publication6
Motifi155 – 170Bipartite nuclear localization signalAdd BLAST16

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi110 – 230Glu-richAdd BLAST121

Domaini

The PWWP domain harbors the heparin-binding sites and is responsible for DNA-binding, while the C-terminal region is essentially unstructured.

Sequence similaritiesi

Belongs to the HDGF family.Curated

Phylogenomic databases

eggNOGiENOG410IMJ5 Eukaryota
ENOG4111IFT LUCA
GeneTreeiENSGT00530000063013
HOGENOMiHOG000112874
HOVERGENiHBG010574
InParanoidiP51858
KOiK16641
OMAiGEKKGNT
OrthoDBiEOG091G045X
PhylomeDBiP51858
TreeFamiTF105385

Family and domain databases

CDDicd05834 HDGF_related, 1 hit
InterProiView protein in InterPro
IPR035496 HDGF-rel_PWWP
IPR000313 PWWP_dom
PfamiView protein in Pfam
PF00855 PWWP, 1 hit
SMARTiView protein in SMART
SM00293 PWWP, 1 hit
PROSITEiView protein in PROSITE
PS50812 PWWP, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P51858-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRSNRQKEY KCGDLVFAKM KGYPHWPARI DEMPEAAVKS TANKYQVFFF
60 70 80 90 100
GTHETAFLGP KDLFPYEESK EKFGKPNKRK GFSEGLWEIE NNPTVKASGY
110 120 130 140 150
QSSQKKSCVE EPEPEPEAAE GDGDKKGNAE GSSDEEGKLV IDEPAKEKNE
160 170 180 190 200
KGALKRRAGD LLEDSPKRPK EAENPEGEEK EAATLEVERP LPMEVEKNST
210 220 230 240
PSEPGSGRGP PQEEEEEEDE EEEATKEDAE APGIRDHESL
Length:240
Mass (Da):26,788
Last modified:October 1, 1996 - v1
Checksum:iDD60D9203BDD4B34
GO
Isoform 2 (identifier: P51858-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MSRSNRQKEYKCGDLVFAKMKGYPHWPAR → MEQRAGGNRVQTSTLNCAGAAV

Note: No experimental confirmation available.
Show »
Length:233
Mass (Da):25,538
Checksum:i629AFF8900895888
GO
Isoform 3 (identifier: P51858-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MSRSNRQKEYKCGDLVFAKMKGYPHWPAR → MHPEGGQFVPQLLGHLLATKLKRFLLSKGGRRAQIPDVSRATPHT

Note: Gene prediction based on EST data.
Show »
Length:256
Mass (Da):28,264
Checksum:iD9D2BC3056553CF9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti206S → P in BAG53283 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061209201P → L1 PublicationCorresponds to variant dbSNP:rs4399146Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0456201 – 29MSRSN…HWPAR → MEQRAGGNRVQTSTLNCAGA AV in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0473281 – 29MSRSN…HWPAR → MHPEGGQFVPQLLGHLLATK LKRFLLSKGGRRAQIPDVSR ATPHT in isoform 3. CuratedAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D16431 mRNA Translation: BAA03903.1
AK096411 mRNA Translation: BAG53283.1
AL590666 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52910.1
CH471121 Genomic DNA Translation: EAW52911.1
CH471121 Genomic DNA Translation: EAW52912.1
BC018991 mRNA Translation: AAH18991.1
CCDSiCCDS1156.1 [P51858-1]
CCDS44247.1 [P51858-3]
CCDS44248.1 [P51858-2]
PIRiA55055
RefSeqiNP_001119522.1, NM_001126050.1 [P51858-3]
NP_001119523.1, NM_001126051.1 [P51858-2]
NP_001306115.1, NM_001319186.1
NP_001306116.1, NM_001319187.1
NP_001306117.1, NM_001319188.1
NP_004485.1, NM_004494.2 [P51858-1]
UniGeneiHs.743948

Genome annotation databases

EnsembliENST00000357325; ENSP00000349878; ENSG00000143321 [P51858-1]
ENST00000368206; ENSP00000357189; ENSG00000143321 [P51858-3]
ENST00000368209; ENSP00000357192; ENSG00000143321 [P51858-2]
ENST00000537739; ENSP00000443120; ENSG00000143321 [P51858-1]
GeneIDi3068
KEGGihsa:3068
UCSCiuc001fpy.5 human [P51858-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiHDGF_HUMAN
AccessioniPrimary (citable) accession number: P51858
Secondary accession number(s): B3KU21
, D3DVC9, Q5SZ07, Q5SZ08, Q5SZ09
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: May 23, 2018
This is version 167 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health