Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P51814 (ZNF41_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 148. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 41
Gene names
Name:ZNF41
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length821 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May be involved in transcriptional regulation.

Subcellular location

Nucleus Potential.

Tissue specificity

Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Ref.7

Involvement in disease

A chromosomal aberration involving ZNF41 has been found in a patient with severe mental retardation. Translocation t(X;7)(p11.3;q11.21).

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 18 C2H2-type zinc fingers.

Contains 1 KRAB domain.

Caution

Although ZNF41 has been reported to be involved in X-linked mental retardation (Ref.7), its pathological role is questionable (Ref.8).

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P51814-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P51814-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV
Isoform 3 (identifier: P51814-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRS → MGTLPHGPRPWLQRDVAAHV
Isoform 4 (identifier: P51814-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-128: Missing.
Isoform 5 (identifier: P51814-5)

The sequence of this isoform differs from the canonical sequence as follows:
     53-60: Missing.
Isoform 6 (identifier: P51814-6)

The sequence of this isoform differs from the canonical sequence as follows:
     25-66: Missing.
Isoform 7 (identifier: P51814-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV
     141-176: Missing.
Isoform 8 (identifier: P51814-8)

The sequence of this isoform differs from the canonical sequence as follows:
     25-66: Missing.
     141-176: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 821821Zinc finger protein 41
PRO_0000047374

Regions

Domain69 – 14072KRAB
Zinc finger313 – 33523C2H2-type 1
Zinc finger341 – 36424C2H2-type 2; degenerate
Zinc finger369 – 39123C2H2-type 3
Zinc finger397 – 41923C2H2-type 4
Zinc finger425 – 44723C2H2-type 5
Zinc finger453 – 47523C2H2-type 6
Zinc finger481 – 50323C2H2-type 7
Zinc finger509 – 53123C2H2-type 8
Zinc finger537 – 55923C2H2-type 9
Zinc finger565 – 58723C2H2-type 10
Zinc finger593 – 61523C2H2-type 11
Zinc finger621 – 64323C2H2-type 12
Zinc finger649 – 67123C2H2-type 13
Zinc finger677 – 69923C2H2-type 14
Zinc finger705 – 72723C2H2-type 15
Zinc finger733 – 75523C2H2-type 16
Zinc finger761 – 78323C2H2-type 17
Zinc finger789 – 81123C2H2-type 18

Natural variations

Alternative sequence1 – 128128Missing in isoform 4.
VSP_006887
Alternative sequence1 – 6060MAANG…HAALN → MGTLPHGPRPWLQRDVAAHV in isoform 7 and isoform 2.
VSP_006883
Alternative sequence1 – 5252MAANG…PKGRS → MGTLPHGPRPWLQRDVAAHV in isoform 3.
VSP_006884
Alternative sequence25 – 6642Missing in isoform 6 and isoform 8.
VSP_006885
Alternative sequence53 – 608Missing in isoform 5.
VSP_006886
Alternative sequence141 – 17636Missing in isoform 7 and isoform 8.
VSP_006888
Natural variant1531P → L Rare variant found in patients with X-linked mental retardation; unknown pathological significance. Ref.7 Ref.8
Corresponds to variant rs104894955 [ dbSNP | Ensembl ].
VAR_021785
Natural variant1671I → R. Ref.7
Corresponds to variant rs17147624 [ dbSNP | Ensembl ].
VAR_021786
Natural variant3571D → E. Ref.7
Corresponds to variant rs2498170 [ dbSNP | Ensembl ].
VAR_021787

Experimental info

Sequence conflict1111Q → R in CAB53039. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 23, 2002. Version 2.
Checksum: F44B7808C9A8AF13

FASTA82193,728
        10         20         30         40         50         60 
MAANGDSPPW SPALAAEGRG SSCEVRRERT PEARIHSVKR YPDLSPGPKG RSSADHAALN 

        70         80         90        100        110        120 
SIVSLQASVS FEDVTVDFSK EEWQHLDPAQ RRLYWDVTLE NYSHLLSVGY QIPKSEAAFK 

       130        140        150        160        170        180 
LEQGEGPWML EGEAPHQSCS GEAIGKMQQQ GIPGGIFFHC ERFDQPIGED SLCSILEELW 

       190        200        210        220        230        240 
QDNDQLEQRQ ENQNNLLSHV KVLIKERGYE HKNIEKIIHV TTKLVPSIKR LHNCDTILKH 

       250        260        270        280        290        300 
TLNSHNHNRN SATKNLGKIF GNGNNFPHSP SSTKNENAKT GANSCEHDHY EKHLSHKQAP 

       310        320        330        340        350        360 
THHQKIHPEE KLYVCTECVM GFTQKSHLFE HQRIHAGEKS RECDKSNKVF PQKPQVDVHP 

       370        380        390        400        410        420 
SVYTGEKPYL CTQCGKVFTL KSNLITHQKI HTGQKPYKCS ECGKAFFQRS DLFRHLRIHT 

       430        440        450        460        470        480 
GEKPYECSEC GKGFSQNSDL SIHQKTHTGE KHYECNECGK AFTRKSALRM HQRIHTGEKP 

       490        500        510        520        530        540 
YVCADCGKAF IQKSHFNTHQ RIHTGEKPYE CSDCGKSFTK KSQLHVHQRI HTGEKPYICT 

       550        560        570        580        590        600 
ECGKVFTHRT NLTTHQKTHT GEKPYMCAEC GKAFTDQSNL IKHQKTHTGE KPYKCNGCGK 

       610        620        630        640        650        660 
AFIWKSRLKI HQKSHIGERH YECKDCGKAF IQKSTLSVHQ RIHTGEKPYV CPECGKAFIQ 

       670        680        690        700        710        720 
KSHFIAHHRI HTGEKPYECS DCGKCFTKKS QLRVHQKIHT GEKPNICAEC GKAFTDRSNL 

       730        740        750        760        770        780 
ITHQKIHTRE KPYECGDCGK TFTWKSRLNI HQKSHTGERH YECSKCGKAF IQKATLSMHQ 

       790        800        810        820 
IIHTGKKPYA CTECQKAFTD RSNLIKHQKM HSGEKRYKAS D 

« Hide

Isoform 2 [UniParc].

Checksum: B0531CFE87C20260
Show »

FASTA78189,598
Isoform 3 [UniParc].

Checksum: 076E49C3D94E3255
Show »

FASTA78990,377
Isoform 4 [UniParc].

Checksum: D41671F68B91656B
Show »

FASTA69379,538
Isoform 5 [UniParc].

Checksum: 14FF48F2EADA1687
Show »

FASTA81392,948
Isoform 6 [UniParc].

Checksum: B0EF06F2B69F97F1
Show »

FASTA77989,093
Isoform 7 [UniParc].

Checksum: 3A0B309355565CA4
Show »

FASTA74585,693
Isoform 8 [UniParc].

Checksum: 0BC6B01F1914D57E
Show »

FASTA74385,188

References

« Hide 'large scale' references
[1]"Coding region intron/exon organization, alternative splicing and X-chromosome inactivation of the KRAB/FPB-domain-containing human zinc finger gene ZNF41."
Rosati M., Franze A., Matarazzo M.R., Grimaldi G.
Cytogenet. Cell Genet. 85:291-296(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6).
Tissue: Brain and Hippocampus.
[3]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
Tissue: Uterus.
[6]"Isolation and expression analysis of a human zinc finger gene (ZNF41) located on the short arm of the X chromosome."
Franze A., Archidiacono N., Rocchi M., Marino M., Grimaldi G.
Genomics 9:728-736(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 280-821.
[7]"Mutations in the ZNF41 gene are associated with cognitive deficits: identification of a new candidate for X-linked mental retardation."
Shoichet S.A., Hoffmann K., Menzel C., Trautmann U., Moser B., Hoeltzenbein M., Echenne B., Partington M., Van Bokhoven H., Moraine C., Fryns J.-P., Chelly J., Rott H.-D., Ropers H.-H., Kalscheuer V.M.
Am. J. Hum. Genet. 73:1341-1354(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY, CHROMOSOMAL TRANSLOCATION, VARIANTS LEU-153; ARG-167 AND GLU-357, POSSIBLE ASSOCIATION OF VARIANT LEU-153 WITH X-LINKED MENTAL RETARDATION.
[8]"XLID-causing mutations and associated genes challenged in light of data from large-scale human exome sequencing."
Piton A., Redin C., Mandel J.L.
Am. J. Hum. Genet. 93:368-383(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: LACK OF ASSOCIATION OF VARIANT LEU-153 WITH X-LINKED MENTAL RETARDATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X60155 mRNA. Translation: CAB51740.1.
AJ010017 mRNA. Translation: CAB53035.1.
AJ010018 mRNA. Translation: CAB53036.1.
AJ010019 mRNA. Translation: CAB53037.1.
AJ010020 mRNA. Translation: CAB53038.1.
AJ010021 mRNA. Translation: CAB53039.1.
AJ010022 mRNA. Translation: CAB53040.1.
AJ010023 mRNA. Translation: CAB53041.1.
AK290021 mRNA. Translation: BAF82710.1.
AK294858 mRNA. Translation: BAG57962.1.
AL590283, AL590223 Genomic DNA. Translation: CAI41627.1.
AL590223, AL590283 Genomic DNA. Translation: CAI41591.1.
CH471164 Genomic DNA. Translation: EAW59303.1.
BC015023 mRNA. Translation: AAH15023.1.
M92443 Genomic DNA. Translation: AAA61312.1.
CCDSCCDS14279.1. [P51814-6]
PIRA54661.
RefSeqNP_009061.1. NM_007130.2. [P51814-6]
NP_700359.1. NM_153380.2. [P51814-6]
XP_005272722.1. XM_005272665.2. [P51814-6]
XP_005272723.1. XM_005272666.2. [P51814-6]
XP_005272725.1. XM_005272668.2. [P51814-4]
XP_005272726.1. XM_005272669.2. [P51814-4]
XP_006724613.1. XM_006724550.1. [P51814-5]
XP_006724614.1. XM_006724551.1. [P51814-5]
XP_006724615.1. XM_006724552.1. [P51814-5]
XP_006724616.1. XM_006724553.1. [P51814-5]
XP_006724617.1. XM_006724554.1. [P51814-3]
XP_006724618.1. XM_006724555.1. [P51814-3]
XP_006724619.1. XM_006724556.1. [P51814-2]
XP_006724620.1. XM_006724557.1. [P51814-6]
XP_006724621.1. XM_006724558.1. [P51814-4]
UniGeneHs.496074.
Hs.737678.

3D structure databases

ProteinModelPortalP51814.
SMRP51814. Positions 64-110, 292-815.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid113418. 3 interactions.
IntActP51814. 2 interactions.
MINTMINT-1188906.

PTM databases

PhosphoSiteP51814.

Polymorphism databases

DMDM20141930.

Proteomic databases

PaxDbP51814.
PRIDEP51814.

Protocols and materials databases

DNASU7592.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000313116; ENSP00000315173; ENSG00000147124. [P51814-6]
ENST00000377065; ENSP00000366265; ENSG00000147124. [P51814-6]
ENST00000397050; ENSP00000380243; ENSG00000147124. [P51814-3]
GeneID7592.
KEGGhsa:7592.
UCSCuc004dhs.4. human. [P51814-1]
uc004dhu.4. human. [P51814-5]
uc004dhv.4. human. [P51814-3]
uc004dhw.4. human. [P51814-2]
uc004dhx.4. human. [P51814-6]

Organism-specific databases

CTD7592.
GeneCardsGC0XM047305.
HGNCHGNC:13107. ZNF41.
MIM314995. gene.
neXtProtNX_P51814.
Orphanet777. X-linked non-syndromic intellectual disability.
PharmGKBPA37682.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOVERGENHBG018163.
InParanoidP51814.
KOK09228.
OMAQDNDQLE.
OrthoDBEOG7KSX7Q.
PhylomeDBP51814.
TreeFamTF350810.

Enzyme and pathway databases

ReactomeREACT_71. Gene Expression.

Gene expression databases

ArrayExpressP51814.
BgeeP51814.
GenevestigatorP51814.

Family and domain databases

Gene3D3.30.160.60. 18 hits.
InterProIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
[Graphical view]
SMARTSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 17 hits.
[Graphical view]
SUPFAMSSF109640. SSF109640. 1 hit.
PROSITEPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 17 hits.
PS50157. ZINC_FINGER_C2H2_2. 18 hits.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiZNF41.
GenomeRNAi7592.
NextBio29667.
PROP51814.
SOURCESearch...

Entry information

Entry nameZNF41_HUMAN
AccessionPrimary (citable) accession number: P51814
Secondary accession number(s): A8K1V6 expand/collapse secondary AC list , B4DH01, Q96LE8, Q9UMC4, Q9UMV5, Q9UMV6, Q9UMV7, Q9UMV8, Q9UMV9, Q9UMW0, Q9UMW1
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 23, 2002
Last modified: July 9, 2014
This is version 148 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM