Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 41

Gene

ZNF41

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri313 – 33523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri341 – 36424C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri369 – 39123C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri397 – 41923C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri425 – 44723C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri453 – 47523C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri481 – 50323C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri509 – 53123C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri537 – 55923C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri565 – 58723C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri593 – 61523C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri621 – 64323C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri649 – 67123C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri677 – 69923C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri705 – 72723C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri733 – 75523C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri761 – 78323C2H2-type 17PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri789 – 81123C2H2-type 18PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. sequence-specific DNA binding transcription factor activity Source: GO_Central

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: GO_Central
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_12627. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 41
Gene namesi
Name:ZNF41
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:13107. ZNF41.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving ZNF41 has been found in a patient with severe mental retardation. Translocation t(X;7)(p11.3;q11.21).

Organism-specific databases

Orphaneti777. X-linked non-syndromic intellectual disability.
PharmGKBiPA37682.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 821821Zinc finger protein 41PRO_0000047374Add
BLAST

Proteomic databases

PaxDbiP51814.
PRIDEiP51814.

PTM databases

PhosphoSiteiP51814.

Expressioni

Tissue specificityi

Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.1 Publication

Gene expression databases

BgeeiP51814.
ExpressionAtlasiP51814. baseline.
GenevestigatoriP51814.

Interactioni

Protein-protein interaction databases

BioGridi113418. 4 interactions.
IntActiP51814. 2 interactions.
MINTiMINT-1188906.

Structurei

3D structure databases

ProteinModelPortaliP51814.
SMRiP51814. Positions 64-110, 292-815.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini69 – 14072KRABPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 18 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri313 – 33523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri341 – 36424C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri369 – 39123C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri397 – 41923C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri425 – 44723C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri453 – 47523C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri481 – 50323C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri509 – 53123C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri537 – 55923C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri565 – 58723C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri593 – 61523C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri621 – 64323C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri649 – 67123C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri677 – 69923C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri705 – 72723C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri733 – 75523C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri761 – 78323C2H2-type 17PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri789 – 81123C2H2-type 18PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00780000121848.
HOVERGENiHBG018163.
InParanoidiP51814.
KOiK09228.
OMAiQDNDQLE.
OrthoDBiEOG7KSX7Q.
PhylomeDBiP51814.
TreeFamiTF350810.

Family and domain databases

Gene3Di3.30.160.60. 18 hits.
InterProiIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 17 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 17 hits.
PS50157. ZINC_FINGER_C2H2_2. 18 hits.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: P51814-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAANGDSPPW SPALAAEGRG SSCEVRRERT PEARIHSVKR YPDLSPGPKG
60 70 80 90 100
RSSADHAALN SIVSLQASVS FEDVTVDFSK EEWQHLDPAQ RRLYWDVTLE
110 120 130 140 150
NYSHLLSVGY QIPKSEAAFK LEQGEGPWML EGEAPHQSCS GEAIGKMQQQ
160 170 180 190 200
GIPGGIFFHC ERFDQPIGED SLCSILEELW QDNDQLEQRQ ENQNNLLSHV
210 220 230 240 250
KVLIKERGYE HKNIEKIIHV TTKLVPSIKR LHNCDTILKH TLNSHNHNRN
260 270 280 290 300
SATKNLGKIF GNGNNFPHSP SSTKNENAKT GANSCEHDHY EKHLSHKQAP
310 320 330 340 350
THHQKIHPEE KLYVCTECVM GFTQKSHLFE HQRIHAGEKS RECDKSNKVF
360 370 380 390 400
PQKPQVDVHP SVYTGEKPYL CTQCGKVFTL KSNLITHQKI HTGQKPYKCS
410 420 430 440 450
ECGKAFFQRS DLFRHLRIHT GEKPYECSEC GKGFSQNSDL SIHQKTHTGE
460 470 480 490 500
KHYECNECGK AFTRKSALRM HQRIHTGEKP YVCADCGKAF IQKSHFNTHQ
510 520 530 540 550
RIHTGEKPYE CSDCGKSFTK KSQLHVHQRI HTGEKPYICT ECGKVFTHRT
560 570 580 590 600
NLTTHQKTHT GEKPYMCAEC GKAFTDQSNL IKHQKTHTGE KPYKCNGCGK
610 620 630 640 650
AFIWKSRLKI HQKSHIGERH YECKDCGKAF IQKSTLSVHQ RIHTGEKPYV
660 670 680 690 700
CPECGKAFIQ KSHFIAHHRI HTGEKPYECS DCGKCFTKKS QLRVHQKIHT
710 720 730 740 750
GEKPNICAEC GKAFTDRSNL ITHQKIHTRE KPYECGDCGK TFTWKSRLNI
760 770 780 790 800
HQKSHTGERH YECSKCGKAF IQKATLSMHQ IIHTGKKPYA CTECQKAFTD
810 820
RSNLIKHQKM HSGEKRYKAS D
Length:821
Mass (Da):93,728
Last modified:January 23, 2002 - v2
Checksum:iF44B7808C9A8AF13
GO
Isoform 2 (identifier: P51814-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV

Show »
Length:781
Mass (Da):89,598
Checksum:iB0531CFE87C20260
GO
Isoform 3 (identifier: P51814-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRS → MGTLPHGPRPWLQRDVAAHV

Show »
Length:789
Mass (Da):90,377
Checksum:i076E49C3D94E3255
GO
Isoform 4 (identifier: P51814-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-128: Missing.

Show »
Length:693
Mass (Da):79,538
Checksum:iD41671F68B91656B
GO
Isoform 5 (identifier: P51814-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-60: Missing.

Show »
Length:813
Mass (Da):92,948
Checksum:i14FF48F2EADA1687
GO
Isoform 6 (identifier: P51814-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-66: Missing.

Show »
Length:779
Mass (Da):89,093
Checksum:iB0EF06F2B69F97F1
GO
Isoform 7 (identifier: P51814-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV
     141-176: Missing.

Show »
Length:745
Mass (Da):85,693
Checksum:i3A0B309355565CA4
GO
Isoform 8 (identifier: P51814-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-66: Missing.
     141-176: Missing.

Show »
Length:743
Mass (Da):85,188
Checksum:i0BC6B01F1914D57E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti111 – 1111Q → R in CAB53039. (PubMed:10449920)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti153 – 1531P → L Rare variant found in patients with X-linked mental retardation; unknown pathological significance. 1 Publication
Corresponds to variant rs104894955 [ dbSNP | Ensembl ].
VAR_021785
Natural varianti167 – 1671I → R.1 Publication
Corresponds to variant rs17147624 [ dbSNP | Ensembl ].
VAR_021786
Natural varianti357 – 3571D → E.1 Publication
Corresponds to variant rs2498170 [ dbSNP | Ensembl ].
VAR_021787

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 128128Missing in isoform 4. 1 PublicationVSP_006887Add
BLAST
Alternative sequencei1 – 6060MAANG…HAALN → MGTLPHGPRPWLQRDVAAHV in isoform 7 and isoform 2. CuratedVSP_006883Add
BLAST
Alternative sequencei1 – 5252MAANG…PKGRS → MGTLPHGPRPWLQRDVAAHV in isoform 3. CuratedVSP_006884Add
BLAST
Alternative sequencei25 – 6642Missing in isoform 6 and isoform 8. 2 PublicationsVSP_006885Add
BLAST
Alternative sequencei53 – 608Missing in isoform 5. CuratedVSP_006886
Alternative sequencei141 – 17636Missing in isoform 7 and isoform 8. CuratedVSP_006888Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X60155 mRNA. Translation: CAB51740.1.
AJ010017 mRNA. Translation: CAB53035.1.
AJ010018 mRNA. Translation: CAB53036.1.
AJ010019 mRNA. Translation: CAB53037.1.
AJ010020 mRNA. Translation: CAB53038.1.
AJ010021 mRNA. Translation: CAB53039.1.
AJ010022 mRNA. Translation: CAB53040.1.
AJ010023 mRNA. Translation: CAB53041.1.
AK290021 mRNA. Translation: BAF82710.1.
AK294858 mRNA. Translation: BAG57962.1.
AL590283, AL590223 Genomic DNA. Translation: CAI41627.1.
AL590223, AL590283 Genomic DNA. Translation: CAI41591.1.
CH471164 Genomic DNA. Translation: EAW59303.1.
BC015023 mRNA. Translation: AAH15023.1.
M92443 Genomic DNA. Translation: AAA61312.1.
CCDSiCCDS14279.1. [P51814-6]
PIRiA54661.
RefSeqiNP_009061.1. NM_007130.2. [P51814-6]
NP_700359.1. NM_153380.2. [P51814-6]
XP_005272722.1. XM_005272665.2. [P51814-6]
XP_005272723.1. XM_005272666.2. [P51814-6]
XP_005272725.1. XM_005272668.2. [P51814-4]
XP_005272726.1. XM_005272669.2. [P51814-4]
XP_006724613.1. XM_006724550.1. [P51814-5]
XP_006724614.1. XM_006724551.1. [P51814-5]
XP_006724615.1. XM_006724552.1. [P51814-5]
XP_006724616.1. XM_006724553.1. [P51814-5]
XP_006724617.1. XM_006724554.1. [P51814-3]
XP_006724618.1. XM_006724555.1. [P51814-3]
XP_006724619.1. XM_006724556.1. [P51814-2]
XP_006724620.1. XM_006724557.1. [P51814-6]
XP_006724621.1. XM_006724558.1. [P51814-4]
UniGeneiHs.496074.
Hs.737678.

Genome annotation databases

EnsembliENST00000313116; ENSP00000315173; ENSG00000147124. [P51814-6]
ENST00000377065; ENSP00000366265; ENSG00000147124. [P51814-6]
GeneIDi7592.
KEGGihsa:7592.
UCSCiuc004dhs.4. human. [P51814-1]
uc004dhu.4. human. [P51814-5]
uc004dhv.4. human. [P51814-3]
uc004dhw.4. human. [P51814-2]
uc004dhx.4. human. [P51814-6]

Polymorphism databases

DMDMi20141930.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X60155 mRNA. Translation: CAB51740.1.
AJ010017 mRNA. Translation: CAB53035.1.
AJ010018 mRNA. Translation: CAB53036.1.
AJ010019 mRNA. Translation: CAB53037.1.
AJ010020 mRNA. Translation: CAB53038.1.
AJ010021 mRNA. Translation: CAB53039.1.
AJ010022 mRNA. Translation: CAB53040.1.
AJ010023 mRNA. Translation: CAB53041.1.
AK290021 mRNA. Translation: BAF82710.1.
AK294858 mRNA. Translation: BAG57962.1.
AL590283, AL590223 Genomic DNA. Translation: CAI41627.1.
AL590223, AL590283 Genomic DNA. Translation: CAI41591.1.
CH471164 Genomic DNA. Translation: EAW59303.1.
BC015023 mRNA. Translation: AAH15023.1.
M92443 Genomic DNA. Translation: AAA61312.1.
CCDSiCCDS14279.1. [P51814-6]
PIRiA54661.
RefSeqiNP_009061.1. NM_007130.2. [P51814-6]
NP_700359.1. NM_153380.2. [P51814-6]
XP_005272722.1. XM_005272665.2. [P51814-6]
XP_005272723.1. XM_005272666.2. [P51814-6]
XP_005272725.1. XM_005272668.2. [P51814-4]
XP_005272726.1. XM_005272669.2. [P51814-4]
XP_006724613.1. XM_006724550.1. [P51814-5]
XP_006724614.1. XM_006724551.1. [P51814-5]
XP_006724615.1. XM_006724552.1. [P51814-5]
XP_006724616.1. XM_006724553.1. [P51814-5]
XP_006724617.1. XM_006724554.1. [P51814-3]
XP_006724618.1. XM_006724555.1. [P51814-3]
XP_006724619.1. XM_006724556.1. [P51814-2]
XP_006724620.1. XM_006724557.1. [P51814-6]
XP_006724621.1. XM_006724558.1. [P51814-4]
UniGeneiHs.496074.
Hs.737678.

3D structure databases

ProteinModelPortaliP51814.
SMRiP51814. Positions 64-110, 292-815.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113418. 4 interactions.
IntActiP51814. 2 interactions.
MINTiMINT-1188906.

PTM databases

PhosphoSiteiP51814.

Polymorphism databases

DMDMi20141930.

Proteomic databases

PaxDbiP51814.
PRIDEiP51814.

Protocols and materials databases

DNASUi7592.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313116; ENSP00000315173; ENSG00000147124. [P51814-6]
ENST00000377065; ENSP00000366265; ENSG00000147124. [P51814-6]
GeneIDi7592.
KEGGihsa:7592.
UCSCiuc004dhs.4. human. [P51814-1]
uc004dhu.4. human. [P51814-5]
uc004dhv.4. human. [P51814-3]
uc004dhw.4. human. [P51814-2]
uc004dhx.4. human. [P51814-6]

Organism-specific databases

CTDi7592.
GeneCardsiGC0XM047305.
HGNCiHGNC:13107. ZNF41.
MIMi314995. gene.
neXtProtiNX_P51814.
Orphaneti777. X-linked non-syndromic intellectual disability.
PharmGKBiPA37682.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00780000121848.
HOVERGENiHBG018163.
InParanoidiP51814.
KOiK09228.
OMAiQDNDQLE.
OrthoDBiEOG7KSX7Q.
PhylomeDBiP51814.
TreeFamiTF350810.

Enzyme and pathway databases

ReactomeiREACT_12627. Generic Transcription Pathway.

Miscellaneous databases

ChiTaRSiZNF41. human.
GeneWikiiZNF41.
GenomeRNAii7592.
NextBioi29667.
PROiP51814.
SOURCEiSearch...

Gene expression databases

BgeeiP51814.
ExpressionAtlasiP51814. baseline.
GenevestigatoriP51814.

Family and domain databases

Gene3Di3.30.160.60. 18 hits.
InterProiIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 17 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 17 hits.
PS50157. ZINC_FINGER_C2H2_2. 18 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Coding region intron/exon organization, alternative splicing and X-chromosome inactivation of the KRAB/FPB-domain-containing human zinc finger gene ZNF41."
    Rosati M., Franze A., Matarazzo M.R., Grimaldi G.
    Cytogenet. Cell Genet. 85:291-296(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6).
    Tissue: Brain and Hippocampus.
  3. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Uterus.
  6. "Isolation and expression analysis of a human zinc finger gene (ZNF41) located on the short arm of the X chromosome."
    Franze A., Archidiacono N., Rocchi M., Marino M., Grimaldi G.
    Genomics 9:728-736(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 280-821.
  7. "Mutations in the ZNF41 gene are associated with cognitive deficits: identification of a new candidate for X-linked mental retardation."
    Shoichet S.A., Hoffmann K., Menzel C., Trautmann U., Moser B., Hoeltzenbein M., Echenne B., Partington M., Van Bokhoven H., Moraine C., Fryns J.-P., Chelly J., Rott H.-D., Ropers H.-H., Kalscheuer V.M.
    Am. J. Hum. Genet. 73:1341-1354(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY, CHROMOSOMAL TRANSLOCATION, VARIANTS LEU-153; ARG-167 AND GLU-357, POSSIBLE ASSOCIATION OF VARIANT LEU-153 WITH X-LINKED MENTAL RETARDATION.
  8. "XLID-causing mutations and associated genes challenged in light of data from large-scale human exome sequencing."
    Piton A., Redin C., Mandel J.L.
    Am. J. Hum. Genet. 93:368-383(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: LACK OF ASSOCIATION OF VARIANT LEU-153 WITH X-LINKED MENTAL RETARDATION.

Entry informationi

Entry nameiZNF41_HUMAN
AccessioniPrimary (citable) accession number: P51814
Secondary accession number(s): A8K1V6
, B4DH01, Q96LE8, Q9UMC4, Q9UMV5, Q9UMV6, Q9UMV7, Q9UMV8, Q9UMV9, Q9UMW0, Q9UMW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 23, 2002
Last modified: February 4, 2015
This is version 154 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Although ZNF41 has been reported to be involved in X-linked mental retardation (PubMed:14628291), its pathological role is questionable (PubMed:23871722).2 Publications

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.