Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P51814

- ZNF41_HUMAN

UniProt

P51814 - ZNF41_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 41

Gene

ZNF41

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri313 – 33523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri341 – 36424C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri369 – 39123C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri397 – 41923C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri425 – 44723C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri453 – 47523C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri481 – 50323C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri509 – 53123C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri537 – 55923C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri565 – 58723C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri593 – 61523C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri621 – 64323C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri649 – 67123C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri677 – 69923C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri705 – 72723C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri733 – 75523C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri761 – 78323C2H2-type 17PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri789 – 81123C2H2-type 18PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. sequence-specific DNA binding transcription factor activity Source: RefGenome

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: RefGenome
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_12627. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 41
Gene namesi
Name:ZNF41
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:13107. ZNF41.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving ZNF41 has been found in a patient with severe mental retardation. Translocation t(X;7)(p11.3;q11.21).

Organism-specific databases

Orphaneti777. X-linked non-syndromic intellectual disability.
PharmGKBiPA37682.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 821821Zinc finger protein 41PRO_0000047374Add
BLAST

Proteomic databases

PaxDbiP51814.
PRIDEiP51814.

PTM databases

PhosphoSiteiP51814.

Expressioni

Tissue specificityi

Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.1 Publication

Gene expression databases

BgeeiP51814.
ExpressionAtlasiP51814. baseline.
GenevestigatoriP51814.

Interactioni

Protein-protein interaction databases

BioGridi113418. 3 interactions.
IntActiP51814. 2 interactions.
MINTiMINT-1188906.

Structurei

3D structure databases

ProteinModelPortaliP51814.
SMRiP51814. Positions 64-110, 292-815.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini69 – 14072KRABPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 18 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri313 – 33523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri341 – 36424C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri369 – 39123C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri397 – 41923C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri425 – 44723C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri453 – 47523C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri481 – 50323C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri509 – 53123C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri537 – 55923C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri565 – 58723C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri593 – 61523C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri621 – 64323C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri649 – 67123C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri677 – 69923C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri705 – 72723C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri733 – 75523C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri761 – 78323C2H2-type 17PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri789 – 81123C2H2-type 18PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00760000118783.
HOVERGENiHBG018163.
InParanoidiP51814.
KOiK09228.
OMAiQDNDQLE.
OrthoDBiEOG7KSX7Q.
PhylomeDBiP51814.
TreeFamiTF350810.

Family and domain databases

Gene3Di3.30.160.60. 18 hits.
InterProiIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 17 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 17 hits.
PS50157. ZINC_FINGER_C2H2_2. 18 hits.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: P51814-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAANGDSPPW SPALAAEGRG SSCEVRRERT PEARIHSVKR YPDLSPGPKG
60 70 80 90 100
RSSADHAALN SIVSLQASVS FEDVTVDFSK EEWQHLDPAQ RRLYWDVTLE
110 120 130 140 150
NYSHLLSVGY QIPKSEAAFK LEQGEGPWML EGEAPHQSCS GEAIGKMQQQ
160 170 180 190 200
GIPGGIFFHC ERFDQPIGED SLCSILEELW QDNDQLEQRQ ENQNNLLSHV
210 220 230 240 250
KVLIKERGYE HKNIEKIIHV TTKLVPSIKR LHNCDTILKH TLNSHNHNRN
260 270 280 290 300
SATKNLGKIF GNGNNFPHSP SSTKNENAKT GANSCEHDHY EKHLSHKQAP
310 320 330 340 350
THHQKIHPEE KLYVCTECVM GFTQKSHLFE HQRIHAGEKS RECDKSNKVF
360 370 380 390 400
PQKPQVDVHP SVYTGEKPYL CTQCGKVFTL KSNLITHQKI HTGQKPYKCS
410 420 430 440 450
ECGKAFFQRS DLFRHLRIHT GEKPYECSEC GKGFSQNSDL SIHQKTHTGE
460 470 480 490 500
KHYECNECGK AFTRKSALRM HQRIHTGEKP YVCADCGKAF IQKSHFNTHQ
510 520 530 540 550
RIHTGEKPYE CSDCGKSFTK KSQLHVHQRI HTGEKPYICT ECGKVFTHRT
560 570 580 590 600
NLTTHQKTHT GEKPYMCAEC GKAFTDQSNL IKHQKTHTGE KPYKCNGCGK
610 620 630 640 650
AFIWKSRLKI HQKSHIGERH YECKDCGKAF IQKSTLSVHQ RIHTGEKPYV
660 670 680 690 700
CPECGKAFIQ KSHFIAHHRI HTGEKPYECS DCGKCFTKKS QLRVHQKIHT
710 720 730 740 750
GEKPNICAEC GKAFTDRSNL ITHQKIHTRE KPYECGDCGK TFTWKSRLNI
760 770 780 790 800
HQKSHTGERH YECSKCGKAF IQKATLSMHQ IIHTGKKPYA CTECQKAFTD
810 820
RSNLIKHQKM HSGEKRYKAS D
Length:821
Mass (Da):93,728
Last modified:January 23, 2002 - v2
Checksum:iF44B7808C9A8AF13
GO
Isoform 2 (identifier: P51814-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV

Show »
Length:781
Mass (Da):89,598
Checksum:iB0531CFE87C20260
GO
Isoform 3 (identifier: P51814-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRS → MGTLPHGPRPWLQRDVAAHV

Show »
Length:789
Mass (Da):90,377
Checksum:i076E49C3D94E3255
GO
Isoform 4 (identifier: P51814-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-128: Missing.

Show »
Length:693
Mass (Da):79,538
Checksum:iD41671F68B91656B
GO
Isoform 5 (identifier: P51814-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-60: Missing.

Show »
Length:813
Mass (Da):92,948
Checksum:i14FF48F2EADA1687
GO
Isoform 6 (identifier: P51814-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-66: Missing.

Show »
Length:779
Mass (Da):89,093
Checksum:iB0EF06F2B69F97F1
GO
Isoform 7 (identifier: P51814-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV
     141-176: Missing.

Show »
Length:745
Mass (Da):85,693
Checksum:i3A0B309355565CA4
GO
Isoform 8 (identifier: P51814-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-66: Missing.
     141-176: Missing.

Show »
Length:743
Mass (Da):85,188
Checksum:i0BC6B01F1914D57E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti111 – 1111Q → R in CAB53039. (PubMed:10449920)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti153 – 1531P → L Rare variant found in patients with X-linked mental retardation; unknown pathological significance. 1 Publication
Corresponds to variant rs104894955 [ dbSNP | Ensembl ].
VAR_021785
Natural varianti167 – 1671I → R.1 Publication
Corresponds to variant rs17147624 [ dbSNP | Ensembl ].
VAR_021786
Natural varianti357 – 3571D → E.1 Publication
Corresponds to variant rs2498170 [ dbSNP | Ensembl ].
VAR_021787

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 128128Missing in isoform 4. 1 PublicationVSP_006887Add
BLAST
Alternative sequencei1 – 6060MAANG…HAALN → MGTLPHGPRPWLQRDVAAHV in isoform 7 and isoform 2. CuratedVSP_006883Add
BLAST
Alternative sequencei1 – 5252MAANG…PKGRS → MGTLPHGPRPWLQRDVAAHV in isoform 3. CuratedVSP_006884Add
BLAST
Alternative sequencei25 – 6642Missing in isoform 6 and isoform 8. 2 PublicationsVSP_006885Add
BLAST
Alternative sequencei53 – 608Missing in isoform 5. CuratedVSP_006886
Alternative sequencei141 – 17636Missing in isoform 7 and isoform 8. CuratedVSP_006888Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X60155 mRNA. Translation: CAB51740.1.
AJ010017 mRNA. Translation: CAB53035.1.
AJ010018 mRNA. Translation: CAB53036.1.
AJ010019 mRNA. Translation: CAB53037.1.
AJ010020 mRNA. Translation: CAB53038.1.
AJ010021 mRNA. Translation: CAB53039.1.
AJ010022 mRNA. Translation: CAB53040.1.
AJ010023 mRNA. Translation: CAB53041.1.
AK290021 mRNA. Translation: BAF82710.1.
AK294858 mRNA. Translation: BAG57962.1.
AL590283, AL590223 Genomic DNA. Translation: CAI41627.1.
AL590223, AL590283 Genomic DNA. Translation: CAI41591.1.
CH471164 Genomic DNA. Translation: EAW59303.1.
BC015023 mRNA. Translation: AAH15023.1.
M92443 Genomic DNA. Translation: AAA61312.1.
CCDSiCCDS14279.1. [P51814-6]
PIRiA54661.
RefSeqiNP_009061.1. NM_007130.2. [P51814-6]
NP_700359.1. NM_153380.2. [P51814-6]
XP_005272722.1. XM_005272665.2. [P51814-6]
XP_005272723.1. XM_005272666.2. [P51814-6]
XP_005272725.1. XM_005272668.2. [P51814-4]
XP_005272726.1. XM_005272669.2. [P51814-4]
XP_006724613.1. XM_006724550.1. [P51814-5]
XP_006724614.1. XM_006724551.1. [P51814-5]
XP_006724615.1. XM_006724552.1. [P51814-5]
XP_006724616.1. XM_006724553.1. [P51814-5]
XP_006724617.1. XM_006724554.1. [P51814-3]
XP_006724618.1. XM_006724555.1. [P51814-3]
XP_006724619.1. XM_006724556.1. [P51814-2]
XP_006724620.1. XM_006724557.1. [P51814-6]
XP_006724621.1. XM_006724558.1. [P51814-4]
UniGeneiHs.496074.
Hs.737678.

Genome annotation databases

EnsembliENST00000313116; ENSP00000315173; ENSG00000147124. [P51814-6]
ENST00000377065; ENSP00000366265; ENSG00000147124. [P51814-6]
GeneIDi7592.
KEGGihsa:7592.
UCSCiuc004dhs.4. human. [P51814-1]
uc004dhu.4. human. [P51814-5]
uc004dhv.4. human. [P51814-3]
uc004dhw.4. human. [P51814-2]
uc004dhx.4. human. [P51814-6]

Polymorphism databases

DMDMi20141930.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X60155 mRNA. Translation: CAB51740.1 .
AJ010017 mRNA. Translation: CAB53035.1 .
AJ010018 mRNA. Translation: CAB53036.1 .
AJ010019 mRNA. Translation: CAB53037.1 .
AJ010020 mRNA. Translation: CAB53038.1 .
AJ010021 mRNA. Translation: CAB53039.1 .
AJ010022 mRNA. Translation: CAB53040.1 .
AJ010023 mRNA. Translation: CAB53041.1 .
AK290021 mRNA. Translation: BAF82710.1 .
AK294858 mRNA. Translation: BAG57962.1 .
AL590283 , AL590223 Genomic DNA. Translation: CAI41627.1 .
AL590223 , AL590283 Genomic DNA. Translation: CAI41591.1 .
CH471164 Genomic DNA. Translation: EAW59303.1 .
BC015023 mRNA. Translation: AAH15023.1 .
M92443 Genomic DNA. Translation: AAA61312.1 .
CCDSi CCDS14279.1. [P51814-6 ]
PIRi A54661.
RefSeqi NP_009061.1. NM_007130.2. [P51814-6 ]
NP_700359.1. NM_153380.2. [P51814-6 ]
XP_005272722.1. XM_005272665.2. [P51814-6 ]
XP_005272723.1. XM_005272666.2. [P51814-6 ]
XP_005272725.1. XM_005272668.2. [P51814-4 ]
XP_005272726.1. XM_005272669.2. [P51814-4 ]
XP_006724613.1. XM_006724550.1. [P51814-5 ]
XP_006724614.1. XM_006724551.1. [P51814-5 ]
XP_006724615.1. XM_006724552.1. [P51814-5 ]
XP_006724616.1. XM_006724553.1. [P51814-5 ]
XP_006724617.1. XM_006724554.1. [P51814-3 ]
XP_006724618.1. XM_006724555.1. [P51814-3 ]
XP_006724619.1. XM_006724556.1. [P51814-2 ]
XP_006724620.1. XM_006724557.1. [P51814-6 ]
XP_006724621.1. XM_006724558.1. [P51814-4 ]
UniGenei Hs.496074.
Hs.737678.

3D structure databases

ProteinModelPortali P51814.
SMRi P51814. Positions 64-110, 292-815.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113418. 3 interactions.
IntActi P51814. 2 interactions.
MINTi MINT-1188906.

PTM databases

PhosphoSitei P51814.

Polymorphism databases

DMDMi 20141930.

Proteomic databases

PaxDbi P51814.
PRIDEi P51814.

Protocols and materials databases

DNASUi 7592.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000313116 ; ENSP00000315173 ; ENSG00000147124 . [P51814-6 ]
ENST00000377065 ; ENSP00000366265 ; ENSG00000147124 . [P51814-6 ]
GeneIDi 7592.
KEGGi hsa:7592.
UCSCi uc004dhs.4. human. [P51814-1 ]
uc004dhu.4. human. [P51814-5 ]
uc004dhv.4. human. [P51814-3 ]
uc004dhw.4. human. [P51814-2 ]
uc004dhx.4. human. [P51814-6 ]

Organism-specific databases

CTDi 7592.
GeneCardsi GC0XM047305.
HGNCi HGNC:13107. ZNF41.
MIMi 314995. gene.
neXtProti NX_P51814.
Orphaneti 777. X-linked non-syndromic intellectual disability.
PharmGKBi PA37682.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
GeneTreei ENSGT00760000118783.
HOVERGENi HBG018163.
InParanoidi P51814.
KOi K09228.
OMAi QDNDQLE.
OrthoDBi EOG7KSX7Q.
PhylomeDBi P51814.
TreeFami TF350810.

Enzyme and pathway databases

Reactomei REACT_12627. Generic Transcription Pathway.

Miscellaneous databases

GeneWikii ZNF41.
GenomeRNAii 7592.
NextBioi 29667.
PROi P51814.
SOURCEi Search...

Gene expression databases

Bgeei P51814.
ExpressionAtlasi P51814. baseline.
Genevestigatori P51814.

Family and domain databases

Gene3Di 3.30.160.60. 18 hits.
InterProi IPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 2 hits.
[Graphical view ]
SMARTi SM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 17 hits.
[Graphical view ]
SUPFAMi SSF109640. SSF109640. 1 hit.
PROSITEi PS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 17 hits.
PS50157. ZINC_FINGER_C2H2_2. 18 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Coding region intron/exon organization, alternative splicing and X-chromosome inactivation of the KRAB/FPB-domain-containing human zinc finger gene ZNF41."
    Rosati M., Franze A., Matarazzo M.R., Grimaldi G.
    Cytogenet. Cell Genet. 85:291-296(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6).
    Tissue: Brain and Hippocampus.
  3. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Uterus.
  6. "Isolation and expression analysis of a human zinc finger gene (ZNF41) located on the short arm of the X chromosome."
    Franze A., Archidiacono N., Rocchi M., Marino M., Grimaldi G.
    Genomics 9:728-736(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 280-821.
  7. "Mutations in the ZNF41 gene are associated with cognitive deficits: identification of a new candidate for X-linked mental retardation."
    Shoichet S.A., Hoffmann K., Menzel C., Trautmann U., Moser B., Hoeltzenbein M., Echenne B., Partington M., Van Bokhoven H., Moraine C., Fryns J.-P., Chelly J., Rott H.-D., Ropers H.-H., Kalscheuer V.M.
    Am. J. Hum. Genet. 73:1341-1354(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY, CHROMOSOMAL TRANSLOCATION, VARIANTS LEU-153; ARG-167 AND GLU-357, POSSIBLE ASSOCIATION OF VARIANT LEU-153 WITH X-LINKED MENTAL RETARDATION.
  8. "XLID-causing mutations and associated genes challenged in light of data from large-scale human exome sequencing."
    Piton A., Redin C., Mandel J.L.
    Am. J. Hum. Genet. 93:368-383(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: LACK OF ASSOCIATION OF VARIANT LEU-153 WITH X-LINKED MENTAL RETARDATION.

Entry informationi

Entry nameiZNF41_HUMAN
AccessioniPrimary (citable) accession number: P51814
Secondary accession number(s): A8K1V6
, B4DH01, Q96LE8, Q9UMC4, Q9UMV5, Q9UMV6, Q9UMV7, Q9UMV8, Q9UMV9, Q9UMW0, Q9UMW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 23, 2002
Last modified: October 29, 2014
This is version 151 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Although ZNF41 has been reported to be involved in X-linked mental retardation (PubMed:14628291), its pathological role is questionable (PubMed:23871722).2 Publications

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3