Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P51814

- ZNF41_HUMAN

UniProt

P51814 - ZNF41_HUMAN

Protein

Zinc finger protein 41

Gene

ZNF41

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 150 (01 Oct 2014)
      Sequence version 2 (23 Jan 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in transcriptional regulation.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri313 – 33523C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri341 – 36424C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri369 – 39123C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri397 – 41923C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri425 – 44723C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri453 – 47523C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri481 – 50323C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri509 – 53123C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri537 – 55923C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri565 – 58723C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri593 – 61523C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri621 – 64323C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri649 – 67123C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri677 – 69923C2H2-type 14PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri705 – 72723C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri733 – 75523C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri761 – 78323C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri789 – 81123C2H2-type 18PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW
    3. sequence-specific DNA binding transcription factor activity Source: RefGenome

    GO - Biological processi

    1. regulation of transcription, DNA-templated Source: RefGenome
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_12627. Generic Transcription Pathway.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 41
    Gene namesi
    Name:ZNF41
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:13107. ZNF41.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving ZNF41 has been found in a patient with severe mental retardation. Translocation t(X;7)(p11.3;q11.21).

    Organism-specific databases

    Orphaneti777. X-linked non-syndromic intellectual disability.
    PharmGKBiPA37682.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 821821Zinc finger protein 41PRO_0000047374Add
    BLAST

    Proteomic databases

    PaxDbiP51814.
    PRIDEiP51814.

    PTM databases

    PhosphoSiteiP51814.

    Expressioni

    Tissue specificityi

    Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.1 Publication

    Gene expression databases

    ArrayExpressiP51814.
    BgeeiP51814.
    GenevestigatoriP51814.

    Interactioni

    Protein-protein interaction databases

    BioGridi113418. 3 interactions.
    IntActiP51814. 2 interactions.
    MINTiMINT-1188906.

    Structurei

    3D structure databases

    ProteinModelPortaliP51814.
    SMRiP51814. Positions 64-110, 292-815.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini69 – 14072KRABPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 18 C2H2-type zinc fingers.PROSITE-ProRule annotation
    Contains 1 KRAB domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri313 – 33523C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri341 – 36424C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri369 – 39123C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri397 – 41923C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri425 – 44723C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri453 – 47523C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri481 – 50323C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri509 – 53123C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri537 – 55923C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri565 – 58723C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri593 – 61523C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri621 – 64323C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri649 – 67123C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri677 – 69923C2H2-type 14PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri705 – 72723C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri733 – 75523C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri761 – 78323C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri789 – 81123C2H2-type 18PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOVERGENiHBG018163.
    InParanoidiP51814.
    KOiK09228.
    OMAiQDNDQLE.
    OrthoDBiEOG7KSX7Q.
    PhylomeDBiP51814.
    TreeFamiTF350810.

    Family and domain databases

    Gene3Di3.30.160.60. 18 hits.
    InterProiIPR001909. Krueppel-associated_box.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF01352. KRAB. 1 hit.
    PF00096. zf-C2H2. 2 hits.
    [Graphical view]
    SMARTiSM00349. KRAB. 1 hit.
    SM00355. ZnF_C2H2. 17 hits.
    [Graphical view]
    SUPFAMiSSF109640. SSF109640. 1 hit.
    PROSITEiPS50805. KRAB. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 17 hits.
    PS50157. ZINC_FINGER_C2H2_2. 18 hits.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: P51814-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAANGDSPPW SPALAAEGRG SSCEVRRERT PEARIHSVKR YPDLSPGPKG    50
    RSSADHAALN SIVSLQASVS FEDVTVDFSK EEWQHLDPAQ RRLYWDVTLE 100
    NYSHLLSVGY QIPKSEAAFK LEQGEGPWML EGEAPHQSCS GEAIGKMQQQ 150
    GIPGGIFFHC ERFDQPIGED SLCSILEELW QDNDQLEQRQ ENQNNLLSHV 200
    KVLIKERGYE HKNIEKIIHV TTKLVPSIKR LHNCDTILKH TLNSHNHNRN 250
    SATKNLGKIF GNGNNFPHSP SSTKNENAKT GANSCEHDHY EKHLSHKQAP 300
    THHQKIHPEE KLYVCTECVM GFTQKSHLFE HQRIHAGEKS RECDKSNKVF 350
    PQKPQVDVHP SVYTGEKPYL CTQCGKVFTL KSNLITHQKI HTGQKPYKCS 400
    ECGKAFFQRS DLFRHLRIHT GEKPYECSEC GKGFSQNSDL SIHQKTHTGE 450
    KHYECNECGK AFTRKSALRM HQRIHTGEKP YVCADCGKAF IQKSHFNTHQ 500
    RIHTGEKPYE CSDCGKSFTK KSQLHVHQRI HTGEKPYICT ECGKVFTHRT 550
    NLTTHQKTHT GEKPYMCAEC GKAFTDQSNL IKHQKTHTGE KPYKCNGCGK 600
    AFIWKSRLKI HQKSHIGERH YECKDCGKAF IQKSTLSVHQ RIHTGEKPYV 650
    CPECGKAFIQ KSHFIAHHRI HTGEKPYECS DCGKCFTKKS QLRVHQKIHT 700
    GEKPNICAEC GKAFTDRSNL ITHQKIHTRE KPYECGDCGK TFTWKSRLNI 750
    HQKSHTGERH YECSKCGKAF IQKATLSMHQ IIHTGKKPYA CTECQKAFTD 800
    RSNLIKHQKM HSGEKRYKAS D 821
    Length:821
    Mass (Da):93,728
    Last modified:January 23, 2002 - v2
    Checksum:iF44B7808C9A8AF13
    GO
    Isoform 2 (identifier: P51814-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV

    Show »
    Length:781
    Mass (Da):89,598
    Checksum:iB0531CFE87C20260
    GO
    Isoform 3 (identifier: P51814-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-52: MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRS → MGTLPHGPRPWLQRDVAAHV

    Show »
    Length:789
    Mass (Da):90,377
    Checksum:i076E49C3D94E3255
    GO
    Isoform 4 (identifier: P51814-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-128: Missing.

    Show »
    Length:693
    Mass (Da):79,538
    Checksum:iD41671F68B91656B
    GO
    Isoform 5 (identifier: P51814-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         53-60: Missing.

    Show »
    Length:813
    Mass (Da):92,948
    Checksum:i14FF48F2EADA1687
    GO
    Isoform 6 (identifier: P51814-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         25-66: Missing.

    Show »
    Length:779
    Mass (Da):89,093
    Checksum:iB0EF06F2B69F97F1
    GO
    Isoform 7 (identifier: P51814-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV
         141-176: Missing.

    Show »
    Length:745
    Mass (Da):85,693
    Checksum:i3A0B309355565CA4
    GO
    Isoform 8 (identifier: P51814-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         25-66: Missing.
         141-176: Missing.

    Show »
    Length:743
    Mass (Da):85,188
    Checksum:i0BC6B01F1914D57E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti111 – 1111Q → R in CAB53039. (PubMed:10449920)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti153 – 1531P → L Rare variant found in patients with X-linked mental retardation; unknown pathological significance. 1 Publication
    Corresponds to variant rs104894955 [ dbSNP | Ensembl ].
    VAR_021785
    Natural varianti167 – 1671I → R.1 Publication
    Corresponds to variant rs17147624 [ dbSNP | Ensembl ].
    VAR_021786
    Natural varianti357 – 3571D → E.1 Publication
    Corresponds to variant rs2498170 [ dbSNP | Ensembl ].
    VAR_021787

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 128128Missing in isoform 4. 1 PublicationVSP_006887Add
    BLAST
    Alternative sequencei1 – 6060MAANG…HAALN → MGTLPHGPRPWLQRDVAAHV in isoform 7 and isoform 2. CuratedVSP_006883Add
    BLAST
    Alternative sequencei1 – 5252MAANG…PKGRS → MGTLPHGPRPWLQRDVAAHV in isoform 3. CuratedVSP_006884Add
    BLAST
    Alternative sequencei25 – 6642Missing in isoform 6 and isoform 8. 2 PublicationsVSP_006885Add
    BLAST
    Alternative sequencei53 – 608Missing in isoform 5. CuratedVSP_006886
    Alternative sequencei141 – 17636Missing in isoform 7 and isoform 8. CuratedVSP_006888Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X60155 mRNA. Translation: CAB51740.1.
    AJ010017 mRNA. Translation: CAB53035.1.
    AJ010018 mRNA. Translation: CAB53036.1.
    AJ010019 mRNA. Translation: CAB53037.1.
    AJ010020 mRNA. Translation: CAB53038.1.
    AJ010021 mRNA. Translation: CAB53039.1.
    AJ010022 mRNA. Translation: CAB53040.1.
    AJ010023 mRNA. Translation: CAB53041.1.
    AK290021 mRNA. Translation: BAF82710.1.
    AK294858 mRNA. Translation: BAG57962.1.
    AL590283, AL590223 Genomic DNA. Translation: CAI41627.1.
    AL590223, AL590283 Genomic DNA. Translation: CAI41591.1.
    CH471164 Genomic DNA. Translation: EAW59303.1.
    BC015023 mRNA. Translation: AAH15023.1.
    M92443 Genomic DNA. Translation: AAA61312.1.
    CCDSiCCDS14279.1. [P51814-6]
    PIRiA54661.
    RefSeqiNP_009061.1. NM_007130.2. [P51814-6]
    NP_700359.1. NM_153380.2. [P51814-6]
    XP_005272722.1. XM_005272665.2. [P51814-6]
    XP_005272723.1. XM_005272666.2. [P51814-6]
    XP_005272725.1. XM_005272668.2. [P51814-4]
    XP_005272726.1. XM_005272669.2. [P51814-4]
    XP_006724613.1. XM_006724550.1. [P51814-5]
    XP_006724614.1. XM_006724551.1. [P51814-5]
    XP_006724615.1. XM_006724552.1. [P51814-5]
    XP_006724616.1. XM_006724553.1. [P51814-5]
    XP_006724617.1. XM_006724554.1. [P51814-3]
    XP_006724618.1. XM_006724555.1. [P51814-3]
    XP_006724619.1. XM_006724556.1. [P51814-2]
    XP_006724620.1. XM_006724557.1. [P51814-6]
    XP_006724621.1. XM_006724558.1. [P51814-4]
    UniGeneiHs.496074.
    Hs.737678.

    Genome annotation databases

    EnsembliENST00000313116; ENSP00000315173; ENSG00000147124. [P51814-6]
    ENST00000377065; ENSP00000366265; ENSG00000147124. [P51814-6]
    GeneIDi7592.
    KEGGihsa:7592.
    UCSCiuc004dhs.4. human. [P51814-1]
    uc004dhu.4. human. [P51814-5]
    uc004dhv.4. human. [P51814-3]
    uc004dhw.4. human. [P51814-2]
    uc004dhx.4. human. [P51814-6]

    Polymorphism databases

    DMDMi20141930.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X60155 mRNA. Translation: CAB51740.1 .
    AJ010017 mRNA. Translation: CAB53035.1 .
    AJ010018 mRNA. Translation: CAB53036.1 .
    AJ010019 mRNA. Translation: CAB53037.1 .
    AJ010020 mRNA. Translation: CAB53038.1 .
    AJ010021 mRNA. Translation: CAB53039.1 .
    AJ010022 mRNA. Translation: CAB53040.1 .
    AJ010023 mRNA. Translation: CAB53041.1 .
    AK290021 mRNA. Translation: BAF82710.1 .
    AK294858 mRNA. Translation: BAG57962.1 .
    AL590283 , AL590223 Genomic DNA. Translation: CAI41627.1 .
    AL590223 , AL590283 Genomic DNA. Translation: CAI41591.1 .
    CH471164 Genomic DNA. Translation: EAW59303.1 .
    BC015023 mRNA. Translation: AAH15023.1 .
    M92443 Genomic DNA. Translation: AAA61312.1 .
    CCDSi CCDS14279.1. [P51814-6 ]
    PIRi A54661.
    RefSeqi NP_009061.1. NM_007130.2. [P51814-6 ]
    NP_700359.1. NM_153380.2. [P51814-6 ]
    XP_005272722.1. XM_005272665.2. [P51814-6 ]
    XP_005272723.1. XM_005272666.2. [P51814-6 ]
    XP_005272725.1. XM_005272668.2. [P51814-4 ]
    XP_005272726.1. XM_005272669.2. [P51814-4 ]
    XP_006724613.1. XM_006724550.1. [P51814-5 ]
    XP_006724614.1. XM_006724551.1. [P51814-5 ]
    XP_006724615.1. XM_006724552.1. [P51814-5 ]
    XP_006724616.1. XM_006724553.1. [P51814-5 ]
    XP_006724617.1. XM_006724554.1. [P51814-3 ]
    XP_006724618.1. XM_006724555.1. [P51814-3 ]
    XP_006724619.1. XM_006724556.1. [P51814-2 ]
    XP_006724620.1. XM_006724557.1. [P51814-6 ]
    XP_006724621.1. XM_006724558.1. [P51814-4 ]
    UniGenei Hs.496074.
    Hs.737678.

    3D structure databases

    ProteinModelPortali P51814.
    SMRi P51814. Positions 64-110, 292-815.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113418. 3 interactions.
    IntActi P51814. 2 interactions.
    MINTi MINT-1188906.

    PTM databases

    PhosphoSitei P51814.

    Polymorphism databases

    DMDMi 20141930.

    Proteomic databases

    PaxDbi P51814.
    PRIDEi P51814.

    Protocols and materials databases

    DNASUi 7592.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000313116 ; ENSP00000315173 ; ENSG00000147124 . [P51814-6 ]
    ENST00000377065 ; ENSP00000366265 ; ENSG00000147124 . [P51814-6 ]
    GeneIDi 7592.
    KEGGi hsa:7592.
    UCSCi uc004dhs.4. human. [P51814-1 ]
    uc004dhu.4. human. [P51814-5 ]
    uc004dhv.4. human. [P51814-3 ]
    uc004dhw.4. human. [P51814-2 ]
    uc004dhx.4. human. [P51814-6 ]

    Organism-specific databases

    CTDi 7592.
    GeneCardsi GC0XM047305.
    HGNCi HGNC:13107. ZNF41.
    MIMi 314995. gene.
    neXtProti NX_P51814.
    Orphaneti 777. X-linked non-syndromic intellectual disability.
    PharmGKBi PA37682.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOVERGENi HBG018163.
    InParanoidi P51814.
    KOi K09228.
    OMAi QDNDQLE.
    OrthoDBi EOG7KSX7Q.
    PhylomeDBi P51814.
    TreeFami TF350810.

    Enzyme and pathway databases

    Reactomei REACT_12627. Generic Transcription Pathway.

    Miscellaneous databases

    GeneWikii ZNF41.
    GenomeRNAii 7592.
    NextBioi 29667.
    PROi P51814.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P51814.
    Bgeei P51814.
    Genevestigatori P51814.

    Family and domain databases

    Gene3Di 3.30.160.60. 18 hits.
    InterProi IPR001909. Krueppel-associated_box.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF01352. KRAB. 1 hit.
    PF00096. zf-C2H2. 2 hits.
    [Graphical view ]
    SMARTi SM00349. KRAB. 1 hit.
    SM00355. ZnF_C2H2. 17 hits.
    [Graphical view ]
    SUPFAMi SSF109640. SSF109640. 1 hit.
    PROSITEi PS50805. KRAB. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 17 hits.
    PS50157. ZINC_FINGER_C2H2_2. 18 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Coding region intron/exon organization, alternative splicing and X-chromosome inactivation of the KRAB/FPB-domain-containing human zinc finger gene ZNF41."
      Rosati M., Franze A., Matarazzo M.R., Grimaldi G.
      Cytogenet. Cell Genet. 85:291-296(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6).
      Tissue: Brain and Hippocampus.
    3. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
      Tissue: Uterus.
    6. "Isolation and expression analysis of a human zinc finger gene (ZNF41) located on the short arm of the X chromosome."
      Franze A., Archidiacono N., Rocchi M., Marino M., Grimaldi G.
      Genomics 9:728-736(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 280-821.
    7. "Mutations in the ZNF41 gene are associated with cognitive deficits: identification of a new candidate for X-linked mental retardation."
      Shoichet S.A., Hoffmann K., Menzel C., Trautmann U., Moser B., Hoeltzenbein M., Echenne B., Partington M., Van Bokhoven H., Moraine C., Fryns J.-P., Chelly J., Rott H.-D., Ropers H.-H., Kalscheuer V.M.
      Am. J. Hum. Genet. 73:1341-1354(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY, CHROMOSOMAL TRANSLOCATION, VARIANTS LEU-153; ARG-167 AND GLU-357, POSSIBLE ASSOCIATION OF VARIANT LEU-153 WITH X-LINKED MENTAL RETARDATION.
    8. "XLID-causing mutations and associated genes challenged in light of data from large-scale human exome sequencing."
      Piton A., Redin C., Mandel J.L.
      Am. J. Hum. Genet. 93:368-383(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: LACK OF ASSOCIATION OF VARIANT LEU-153 WITH X-LINKED MENTAL RETARDATION.

    Entry informationi

    Entry nameiZNF41_HUMAN
    AccessioniPrimary (citable) accession number: P51814
    Secondary accession number(s): A8K1V6
    , B4DH01, Q96LE8, Q9UMC4, Q9UMV5, Q9UMV6, Q9UMV7, Q9UMV8, Q9UMV9, Q9UMW0, Q9UMW1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: January 23, 2002
    Last modified: October 1, 2014
    This is version 150 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Caution

    Although ZNF41 has been reported to be involved in X-linked mental retardation (PubMed:14628291), its pathological role is questionable (PubMed:23871722).2 Publications

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3