P51814 (ZNF41_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger protein 41 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 821 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be involved in transcriptional regulation. |
| Subcellular location | Nucleus Potential. |
| Tissue specificity | Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Ref.7 |
| Involvement in disease | Mental retardation, X-linked 89 (MRX89) [MIM:300848]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Intellectual deficiency is the only primary symptom of non-syndromic X-linked mental retardation, while syndromic mental retardation presents with associated physical, neurological and/or psychiatric manifestations. A chromosomal aberration involving ZNF41 has been found in a patient with sever mental retardation. Translocation t(X;7)(p11.3;q11.21). |
| Sequence similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. Contains 18 C2H2-type zinc fingers. Contains 1 KRAB domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement Polymorphism |
| Disease | Disease mutation Mental retardation |
| Domain | Repeat Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleus Non-traceable author statement. Source: UniProtKB |
| Molecular_function | DNA binding Non-traceable author statement. Source: UniProtKB sequence-specific DNA binding transcription factor activityNon-traceable author statement. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P51814-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P51814-2) The sequence of this isoform differs from the canonical sequence as follows: 1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV | ||||||
| Isoform 3 (identifier: P51814-3) The sequence of this isoform differs from the canonical sequence as follows: 1-52: MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRS → MGTLPHGPRPWLQRDVAAHV | ||||||
| Isoform 4 (identifier: P51814-4) The sequence of this isoform differs from the canonical sequence as follows: 1-128: Missing. | ||||||
| Isoform 5 (identifier: P51814-5) The sequence of this isoform differs from the canonical sequence as follows: 53-60: Missing. | ||||||
| Isoform 6 (identifier: P51814-6) The sequence of this isoform differs from the canonical sequence as follows: 25-66: Missing. | ||||||
| Isoform 7 (identifier: P51814-7) The sequence of this isoform differs from the canonical sequence as follows: 1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV 141-176: Missing. | ||||||
| Isoform 8 (identifier: P51814-8) The sequence of this isoform differs from the canonical sequence as follows: 25-66: Missing. 141-176: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 821 | 821 | Zinc finger protein 41 | PRO_0000047374 | |||||
Regions | |||||||||
| Domain | 69 – 140 | 72 | KRAB | ||||||
| Zinc finger | 313 – 335 | 23 | C2H2-type 1 | ||||||
| Zinc finger | 341 – 364 | 24 | C2H2-type 2; degenerate | ||||||
| Zinc finger | 369 – 391 | 23 | C2H2-type 3 | ||||||
| Zinc finger | 397 – 419 | 23 | C2H2-type 4 | ||||||
| Zinc finger | 425 – 447 | 23 | C2H2-type 5 | ||||||
| Zinc finger | 453 – 475 | 23 | C2H2-type 6 | ||||||
| Zinc finger | 481 – 503 | 23 | C2H2-type 7 | ||||||
| Zinc finger | 509 – 531 | 23 | C2H2-type 8 | ||||||
| Zinc finger | 537 – 559 | 23 | C2H2-type 9 | ||||||
| Zinc finger | 565 – 587 | 23 | C2H2-type 10 | ||||||
| Zinc finger | 593 – 615 | 23 | C2H2-type 11 | ||||||
| Zinc finger | 621 – 643 | 23 | C2H2-type 12 | ||||||
| Zinc finger | 649 – 671 | 23 | C2H2-type 13 | ||||||
| Zinc finger | 677 – 699 | 23 | C2H2-type 14 | ||||||
| Zinc finger | 705 – 727 | 23 | C2H2-type 15 | ||||||
| Zinc finger | 733 – 755 | 23 | C2H2-type 16 | ||||||
| Zinc finger | 761 – 783 | 23 | C2H2-type 17 | ||||||
| Zinc finger | 789 – 811 | 23 | C2H2-type 18 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 128 | 128 | Missing in isoform 4. | VSP_006887 | |||||
| Alternative sequence | 1 – 60 | 60 | MAANG…HAALN → MGTLPHGPRPWLQRDVAAHV in isoform 7 and isoform 2. | VSP_006883 | |||||
| Alternative sequence | 1 – 52 | 52 | MAANG…PKGRS → MGTLPHGPRPWLQRDVAAHV in isoform 3. | VSP_006884 | |||||
| Alternative sequence | 25 – 66 | 42 | Missing in isoform 6 and isoform 8. | VSP_006885 | |||||
| Alternative sequence | 53 – 60 | 8 | Missing in isoform 5. | VSP_006886 | |||||
| Alternative sequence | 141 – 176 | 36 | Missing in isoform 7 and isoform 8. | VSP_006888 | |||||
| Natural variant | 153 | 1 | P → L in MRX89. Ref.7 | VAR_021785 | |||||
| Natural variant | 167 | 1 | I → R. Ref.7 Corresponds to variant rs17147624 [ dbSNP | Ensembl ]. | VAR_021786 | |||||
| Natural variant | 357 | 1 | D → E. Ref.7 Corresponds to variant rs2498170 [ dbSNP | Ensembl ]. | VAR_021787 | |||||
Experimental info | |||||||||
| Sequence conflict | 111 | 1 | Q → R in CAB53039. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Coding region intron/exon organization, alternative splicing and X-chromosome inactivation of the KRAB/FPB-domain-containing human zinc finger gene ZNF41." Rosati M., Franze A., Matarazzo M.R., Grimaldi G. Cytogenet. Cell Genet. 85:291-296(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6). Tissue: Brain and Hippocampus. |
| [3] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Uterus. |
| [6] | "Isolation and expression analysis of a human zinc finger gene (ZNF41) located on the short arm of the X chromosome." Franze A., Archidiacono N., Rocchi M., Marino M., Grimaldi G. Genomics 9:728-736(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 280-821. |
| [7] | "Mutations in the ZNF41 gene are associated with cognitive deficits: identification of a new candidate for X-linked mental retardation." Shoichet S.A., Hoffmann K., Menzel C., Trautmann U., Moser B., Hoeltzenbein M., Echenne B., Partington M., Van Bokhoven H., Moraine C., Fryns J.-P., Chelly J., Rott H.-D., Ropers H.-H., Kalscheuer V.M. Am. J. Hum. Genet. 73:1341-1354(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY, CHROMOSOMAL TRANSLOCATION, VARIANT MRX89 LEU-153, VARIANTS ARG-167 AND GLU-357. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X60155 mRNA. Translation: CAB51740.1. AJ010017 mRNA. Translation: CAB53035.1. AJ010018 mRNA. Translation: CAB53036.1. AJ010019 mRNA. Translation: CAB53037.1. AJ010020 mRNA. Translation: CAB53038.1. AJ010021 mRNA. Translation: CAB53039.1. AJ010022 mRNA. Translation: CAB53040.1. AJ010023 mRNA. Translation: CAB53041.1. AK290021 mRNA. Translation: BAF82710.1. AK294858 mRNA. Translation: BAG57962.1. AL590283, AL590223 Genomic DNA. Translation: CAI41627.1. AL590223, AL590283 Genomic DNA. Translation: CAI41591.1. CH471164 Genomic DNA. Translation: EAW59303.1. BC015023 mRNA. Translation: AAH15023.1. M92443 Genomic DNA. Translation: AAA61312.1. |
| IPI | IPI00020900. IPI00221192. IPI00221194. IPI00221195. IPI00221196. IPI00221197. IPI00221198. IPI00221200. |
| PIR | A54661. |
| RefSeq | NP_009061.1. NM_007130.2. NP_700359.1. NM_153380.2. |
| UniGene | Hs.496074. Hs.737678. |
3D structure databases | |
| ProteinModelPortal | P51814. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P51814. 1 interaction. |
| MINT | MINT-1188906. |
PTM databases | |
| PhosphoSite | P51814. |
Polymorphism databases | |
| DMDM | 20141930. |
Proteomic databases | |
| PaxDb | P51814. |
| PRIDE | P51814. |
Protocols and materials databases | |
| DNASU | 7592. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000313116; ENSP00000315173; ENSG00000147124. ENST00000377065; ENSP00000366265; ENSG00000147124. ENST00000397050; ENSP00000380243; ENSG00000147124. |
| GeneID | 7592. |
| KEGG | hsa:7592. |
| UCSC | uc004dhs.4. human. uc004dhu.4. human. uc004dhv.4. human. uc004dhw.4. human. uc004dhx.4. human. |
Organism-specific databases | |
| CTD | 7592. |
| GeneCards | GC0XM047305. |
| HGNC | HGNC:13107. ZNF41. |
| MIM | 300848. phenotype. 314995. gene. |
| neXtProt | NX_P51814. |
| Orphanet | 777. X-linked nonsyndromic intellectual deficit. |
| PharmGKB | PA37682. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5048. |
| HOVERGEN | HBG018163. |
| InParanoid | P51814. |
| KO | K09228. |
| OMA | FIAHHRI. |
Enzyme and pathway databases | |
| Reactome | REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | P51814. |
| Bgee | P51814. |
| Genevestigator | P51814. |
| GermOnline | ENSG00000147124. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.160.60. 18 hits. |
| InterPro | IPR001909. Krueppel-associated_box. IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| Pfam | PF01352. KRAB. 1 hit. PF00096. zf-C2H2. 1 hit. [Graphical view] |
| SMART | SM00349. KRAB. 1 hit. SM00355. ZnF_C2H2. 17 hits. [Graphical view] |
| SUPFAM | SSF109640. Krueppel-associated_box. 1 hit. |
| PROSITE | PS50805. KRAB. 1 hit. PS00028. ZINC_FINGER_C2H2_1. 17 hits. PS50157. ZINC_FINGER_C2H2_2. 18 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 7592. |
| NextBio | 29667. |
| SOURCE | Search... |
Entry information
| Entry name | ZNF41_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P51814 Secondary accession number(s): A8K1V6 Q9UMW1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
