Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P51797 (CLCN6_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 132. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Chloride transport protein 6
Alternative name(s):
Chloride channel protein 6
Short name=ClC-6
Gene names
Name:CLCN6
Synonyms:KIAA0046
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length869 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Chloride transport protein, initially identified as voltage-gated chloride channel. The presence of the conserved gating glutamate residues suggests that is functions as antiporter.

Subcellular location

Endosome membrane; Multi-pass membrane protein. Note: Detected in detergent-resistant lipid rafts. Ref.11

Tissue specificity

Testis, ovary, small intestine, brain and skeletal muscle. Low level expression in aortic and coronary vascular smooth muscle cells, and aortic endothelial cells. Isoform 3 is only detected in kidney. Ref.1 Ref.2 Ref.10

Post-translational modification

N-glycosylated on several asparagine residues. Ref.11

Miscellaneous

The CLC channel family contains both chloride channels and proton-coupled anion transporters that exchange chloride or another anion for protons. The presence of conserved gating glutamate residues is typical for family members that function as antiporters By similarity.

Sequence similarities

Belongs to the chloride channel (TC 2.A.49) family. ClC-6/CLCN6 subfamily. [View classification]

Contains 2 CBS domains.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P51797-1)

Also known as: A; Clc-6a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P51797-2)

Also known as: B; ClC-6b; D2-A1;

The sequence of this isoform differs from the canonical sequence as follows:
     237-320: DKRDFVSAGA...LLNFGEFKCS → YGKRQERLCI...APWIAELWRV
     321-869: Missing.
Isoform 3 (identifier: P51797-3)

Also known as: C; ClC-6c; D1-A1;

The sequence of this isoform differs from the canonical sequence as follows:
     319-353: CSDSDKKCHLWTAMDLGFFVVMGVIGGLLGATFNC → SLREPPCVSGNHRGGVCGLDGVRRMPTDVLFESNR
     354-869: Missing.
Isoform 4 (identifier: P51797-4)

Also known as: D; ClC-6d; D1-A2;

The sequence of this isoform differs from the canonical sequence as follows:
     237-308: DKRDFVSAGA...QFGSWGSFQL → SGCWSCCSFR...APWIAELWRV
     309-869: Missing.
Isoform 5 (identifier: P51797-5)

The sequence of this isoform differs from the canonical sequence as follows:
     844-869: IVGIITRHNLTYEFLQARLRQHYQTI → VSEAPALPPP...LHLRRDLRIR
Note: No experimental confirmation available.
Isoform 6 (identifier: P51797-6)

The sequence of this isoform differs from the canonical sequence as follows:
     50-71: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 869869Chloride transport protein 6
PRO_0000094449

Regions

Topological domain1 – 8080Cytoplasmic By similarity
Transmembrane81 – 11333Helical; By similarity
Transmembrane128 – 15023Helical; By similarity
Intramembrane159 – 1668Helical; By similarity
Transmembrane176 – 19419Helical; By similarity
Transmembrane200 – 21718Helical; By similarity
Intramembrane241 – 25313Helical; By similarity
Intramembrane257 – 2659Helical; By similarity
Transmembrane277 – 29418Helical; By similarity
Transmembrane335 – 36430Helical; By similarity
Transmembrane371 – 39222Helical; By similarity
Transmembrane462 – 48120Helical; By similarity
Transmembrane487 – 51125Helical; By similarity
Intramembrane519 – 53315Helical; By similarity
Intramembrane534 – 5363Note=Loop between two helices; By similarity
Intramembrane537 – 54812Helical; By similarity
Intramembrane549 – 5524Note=Loop between two helices; By similarity
Transmembrane553 – 57119Helical; By similarity
Topological domain572 – 869298Cytoplasmic By similarity
Domain605 – 66258CBS 1
Domain807 – 86862CBS 2
Nucleotide binding630 – 6323ATP By similarity
Nucleotide binding849 – 8524ATP By similarity
Motif156 – 1605Selectivity filter part_1 By similarity
Motif198 – 2025Selectivity filter part_2 By similarity
Motif487 – 4915Selectivity filter part_3 By similarity
Compositional bias4 – 1815Cys-rich

Sites

Binding site1571Chloride By similarity
Binding site4891Chloride; via amide nitrogen By similarity
Binding site5761Chloride By similarity
Site2001Mediates proton transfer from the outer aqueous phase to the interior of the protein; involved in linking H(+) and Cl(-) transport By similarity
Site2671Mediates proton transfer from the protein to the inner aqueous phase By similarity

Amino acid modifications

Glycosylation4101N-linked (GlcNAc...)
Glycosylation4221N-linked (GlcNAc...)
Glycosylation4321N-linked (GlcNAc...)

Natural variations

Alternative sequence50 – 7122Missing in isoform 6.
VSP_047169
Alternative sequence237 – 32084DKRDF…EFKCS → YGKRQERLCISRSGCWSCCS FRGANRGYLVQSRGGFVLLE PRAHVESALLFHVCHLHPQL LPFWDSVWKLGFLPAPWIAE LWRV in isoform 2.
VSP_001043
Alternative sequence237 – 30872DKRDF…GSFQL → SGCWSCCSFRGANRGYLVQS RGGFVLLEPRAHVESALLFH VCHLHPQLLPFWDSVWKLGF LPAPWIAELWRV in isoform 4.
VSP_001047
Alternative sequence309 – 869561Missing in isoform 4.
VSP_001048
Alternative sequence319 – 35335CSDSD…ATFNC → SLREPPCVSGNHRGGVCGLD GVRRMPTDVLFESNR in isoform 3.
VSP_001045
Alternative sequence321 – 869549Missing in isoform 2.
VSP_001044
Alternative sequence354 – 869516Missing in isoform 3.
VSP_001046
Alternative sequence844 – 86926IVGII…HYQTI → VSEAPALPPPLREDPLARCC LCTQASHQKRRHPTRRGECG PTLALNPARLPCTRDPFPCL PADGTSVPLAVLSSQSRAST RLCLPPEMLLFTPYHWCSLV LHLRRDLRIR in isoform 5.
VSP_017188
Natural variant1981E → G. Ref.1 Ref.2 Ref.3 Ref.4 Ref.6 Ref.8 Ref.9
Corresponds to variant rs198400 [ dbSNP | Ensembl ].
VAR_023051

Experimental info

Mutagenesis4101N → A: Abolishes N-glycosylation; when associated with A-422 and A-432. Ref.11
Mutagenesis4221N → A: Abolishes N-glycosylation; when associated with A-410 and A-432. Ref.11
Mutagenesis4321N → A: Abolishes N-glycosylation; when associated with A-410 and A-422. Ref.11
Sequence conflict191G → S in BAG57898. Ref.6
Sequence conflict921G → D in BAG57898. Ref.6
Sequence conflict4421F → S in BAG57898. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (A) (Clc-6a) [UniParc].

Last modified November 2, 2010. Version 2.
Checksum: D625F0C2189EB6F7

FASTA86997,289
        10         20         30         40         50         60 
MAGCRGSLCC CCRWCCCCGE RETRTPEELT ILGETQEEED EILPRKDYES LDYDRCINDP 

        70         80         90        100        110        120 
YLEVLETMDN KKGRRYEAVK WMVVFAIGVC TGLVGLFVDF FVRLFTQLKF GVVQTSVEEC 

       130        140        150        160        170        180 
SQKGCLALSL LELLGFNLTF VFLASLLVLI EPVAAGSGIP EVKCYLNGVK VPGIVRLRTL 

       190        200        210        220        230        240 
LCKVLGVLFS VAGGLFVEKE GPMIHSGSVV GAGLPQFQSI SLRKIQFNFP YFRSDRDKRD 

       250        260        270        280        290        300 
FVSAGAAAGV AAAFGAPIGG TLFSLEEGSS FWNQGLTWKV LFCSMSATFT LNFFRSGIQF 

       310        320        330        340        350        360 
GSWGSFQLPG LLNFGEFKCS DSDKKCHLWT AMDLGFFVVM GVIGGLLGAT FNCLNKRLAK 

       370        380        390        400        410        420 
YRMRNVHPKP KLVRVLESLL VSLVTTVVVF VASMVLGECR QMSSSSQIGN DSFQLQVTED 

       430        440        450        460        470        480 
VNSSIKTFFC PNDTYNDMAT LFFNPQESAI LQLFHQDGTF SPVTLALFFV LYFLLACWTY 

       490        500        510        520        530        540 
GISVPSGLFV PSLLCGAAFG RLVANVLKSY IGLGHIYSGT FALIGAAAFL GGVVRMTISL 

       550        560        570        580        590        600 
TVILIESTNE ITYGLPIMVT LMVAKWTGDF FNKGIYDIHV GLRGVPLLEW ETEVEMDKLR 

       610        620        630        640        650        660 
ASDIMEPNLT YVYPHTRIQS LVSILRTTVH HAFPVVTENR GNEKEFMKGN QLISNNIKFK 

       670        680        690        700        710        720 
KSSILTRAGE QRKRSQSMKS YPSSELRNMC DEHIASEEPA EKEDLLQQML ERRYTPYPNL 

       730        740        750        760        770        780 
YPDQSPSEDW TMEERFRPLT FHGLILRSQL VTLLVRGVCY SESQSSASQP RLSYAEMAED 

       790        800        810        820        830        840 
YPRYPDIHDL DLTLLNPRMI VDVTPYMNPS PFTVSPNTHV SQVFNLFRTM GLRHLPVVNA 

       850        860 
VGEIVGIITR HNLTYEFLQA RLRQHYQTI 

« Hide

Isoform 2 (B) (ClC-6b) (D2-A1) [UniParc].

Checksum: 68604EBB1B15E8CA
Show »

FASTA32036,006
Isoform 3 (C) (ClC-6c) (D1-A1) [UniParc].

Checksum: 078D3E8A2C013E94
Show »

FASTA35338,814
Isoform 4 (D) (ClC-6d) (D1-A2) [UniParc].

Checksum: 60C3293CAC95D6BE
Show »

FASTA30834,515
Isoform 5 [UniParc].

Checksum: 5503065172532131
Show »

FASTA953106,376
Isoform 6 [UniParc].

Checksum: 00E66C8453C4B6F6
Show »

FASTA84794,660

References

« Hide 'large scale' references
[1]"ClC-6 and ClC-7 are two novel broadly expressed members of the CLC chloride channel family."
Brandt S., Jentsch T.J.
FEBS Lett. 377:15-20(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT GLY-198.
Tissue: Brain.
[2]"Alternative splicing of ClC-6 (a member of the ClC chloride-channel family) transcripts generates three truncated isoforms one of which, ClC-6c, is kidney-specific."
Eggermont J., Buyse G., Voets T., Tytgat J., De Smedt H., Droogmans G., Nilius B.
Biochem. J. 325:269-276(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 2; 3 AND 4), NUCLEOTIDE SEQUENCE [MRNA] OF 1-409 (ISOFORM 1), TISSUE SPECIFICITY, VARIANT GLY-198.
Tissue: Chronic myeloid leukemia cell.
[3]"Complete genomic structure of the CLCN6 and CLCN7 putative chloride channel genes."
Kornak U., Boesl M.R., Kubisch C.
Biochim. Biophys. Acta 1447:100-106(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANT GLY-198.
[4]"Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1."
Nomura N., Nagase T., Miyajima N., Sazuka T., Tanaka A., Sato S., Seki N., Kawarabayasi Y., Ishikawa K., Tabata S.
DNA Res. 1:223-229(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-198.
Tissue: Bone marrow.
[5]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[6]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6), VARIANT GLY-198.
Tissue: Brain and Hippocampus.
[7]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLY-198.
[9]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-198.
Tissue: Brain.
[10]"Expression of CLCN voltage-gated chloride channel genes in human blood vessels."
Lamb F.S., Clayton G.H., Liu B.-X., Smith R.L., Barna T.J., Schutte B.C.
J. Mol. Cell. Cardiol. 31:657-666(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
Tissue: Aortic endothelium and Vascular smooth muscle.
[11]"Human ClC-6 is a late endosomal glycoprotein that associates with detergent-resistant lipid domains."
Ignoul S., Simaels J., Hermans D., Annaert W., Eggermont J.
PLoS ONE 2:E474-E474(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, GLYCOSYLATION, MUTAGENESIS OF ASN-410; ASN-422 AND ASN-432.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X83378 mRNA. Translation: CAA58292.1.
X96391 mRNA. Translation: CAA65255.1.
X99472 Genomic DNA. Translation: CAA67835.1.
X99473 mRNA. Translation: CAA67836.1.
X99474 mRNA. Translation: CAA67837.1.
X99475 mRNA. Translation: CAA67838.1.
AF009257 expand/collapse EMBL AC list , AF009247, AF009248, AF009249, AF009250, AF009251, AF009252, AF009253, AF009254, AF009255, AF009256 Genomic DNA. Translation: AAB69287.1.
D28475 mRNA. Translation: BAA05836.4.
AK289999 mRNA. Translation: BAF82688.1.
AK294764 mRNA. Translation: BAG57898.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15891.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15892.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15893.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15894.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15895.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23402.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23403.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23404.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23405.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23406.1.
CH471130 Genomic DNA. Translation: EAW71715.1.
BC117420 mRNA. Translation: AAI17421.1.
BC117424 mRNA. Translation: AAI17425.1.
PIRS68428.
RefSeqNP_001243888.1. NM_001256959.1.
NP_001277.1. NM_001286.3.
UniGeneHs.193043.

3D structure databases

ProteinModelPortalP51797.
SMRP51797. Positions 87-639, 805-860.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107599. 1 interaction.

Chemistry

GuidetoPHARMACOLOGY705.

PTM databases

PhosphoSiteP51797.

Polymorphism databases

DMDM311033364.

Proteomic databases

PaxDbP51797.
PRIDEP51797.

Protocols and materials databases

DNASU1185.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000312413; ENSP00000308367; ENSG00000011021. [P51797-3]
ENST00000346436; ENSP00000234488; ENSG00000011021. [P51797-1]
ENST00000376487; ENSP00000365670; ENSG00000011021. [P51797-6]
ENST00000376496; ENSP00000365679; ENSG00000011021. [P51797-5]
GeneID1185.
KEGGhsa:1185.
UCSCuc001ate.5. human. [P51797-1]
uc009vnf.2. human. [P51797-2]
uc009vng.2. human. [P51797-4]
uc009vnh.2. human. [P51797-3]

Organism-specific databases

CTD1185.
GeneCardsGC01P011866.
HGNCHGNC:2024. CLCN6.
HPAHPA032097.
MIM602726. gene.
neXtProtNX_P51797.
PharmGKBPA26551.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0038.
HOVERGENHBG050985.
KOK05015.
OMATEVEMDK.
OrthoDBEOG7D2FD0.
PhylomeDBP51797.
TreeFamTF313867.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressP51797.
BgeeP51797.
GenevestigatorP51797.

Family and domain databases

Gene3D1.10.3080.10. 2 hits.
InterProIPR000644. CBS_dom.
IPR014743. Cl-channel_core.
IPR001807. Cl-channel_volt-gated.
IPR002248. Cl_channel-6.
[Graphical view]
PfamPF00571. CBS. 1 hit.
PF00654. Voltage_CLC. 1 hit.
[Graphical view]
PRINTSPR00762. CLCHANNEL.
PR01117. CLCHANNEL6.
SMARTSM00116. CBS. 2 hits.
[Graphical view]
SUPFAMSSF81340. SSF81340. 2 hits.
PROSITEPS51371. CBS. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCLCN6. human.
GeneWikiCLCN6.
GenomeRNAi1185.
NextBio35513050.
PROP51797.
SOURCESearch...

Entry information

Entry nameCLCN6_HUMAN
AccessionPrimary (citable) accession number: P51797
Secondary accession number(s): A8K1T4 expand/collapse secondary AC list , B4DGT7, F8W9R3, O60818, O60819, O60820, O60821, P78520, P78521, Q17R81, Q5SNW2, Q5SNW3, Q5SNX1, Q5SNX2, Q5SNX3, Q99427, Q99428, Q99429
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 2, 2010
Last modified: April 16, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM