P51797 (CLCN6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 122.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Chloride transport protein 6 Alternative name(s): Chloride channel protein 6 Short name=ClC-6 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 869 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Chloride transport protein, initially identified as voltage-gated chloride channel. The presence of the conserved gating glutamate residues suggests that is functions as antiporter. |
| Subcellular location | Endosome membrane; Multi-pass membrane protein. Note: Detected in detergent-resistant lipid rafts. Ref.11 |
| Tissue specificity | Testis, ovary, small intestine, brain and skeletal muscle. Low level expression in aortic and coronary vascular smooth muscle cells, and aortic endothelial cells. Isoform C is only detected in kidney. Ref.1 Ref.2 Ref.10 |
| Post-translational modification | N-glycosylated on several asparagine residues. Ref.11 |
| Miscellaneous | The CLC channel family contains both chloride channels and proton-coupled anion transporters that exchange chloride or another anion for protons. The presence of conserved gating glutamate residues is typical for family members that function as antiporters By similarity. |
| Sequence similarities | Belongs to the chloride channel (TC 2.A.49) family. ClC-6/CLCN6 subfamily. [View classification] Contains 2 CBS domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Antiport Ion transport Transport |
| Cellular component | Endosome Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | CBS domain Repeat Transmembrane Transmembrane helix |
| Ligand | ATP-binding Chloride Nucleotide-binding |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell volume homeostasis Non-traceable author statement Ref.1Ref.2. Source: UniProtKB signal transductionNon-traceable author statement Ref.1Ref.2. Source: UniProtKB |
| Cellular_component | endosome membrane Traceable author statement. Source: Reactome integral to membraneNon-traceable author statement Ref.1Ref.2. Source: UniProtKB |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW antiporter activityInferred from electronic annotation. Source: UniProtKB-KW voltage-gated chloride channel activityNon-traceable author statement Ref.1Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: P51797-1) Also known as: Clc-6a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: P51797-2) Also known as: ClC-6b; D2-A1; The sequence of this isoform differs from the canonical sequence as follows: 237-320: DKRDFVSAGA...LLNFGEFKCS → YGKRQERLCI...APWIAELWRV 321-869: Missing. | ||||||
| Isoform C (identifier: P51797-3) Also known as: ClC-6c; D1-A1; The sequence of this isoform differs from the canonical sequence as follows: 319-353: CSDSDKKCHLWTAMDLGFFVVMGVIGGLLGATFNC → SLREPPCVSGNHRGGVCGLDGVRRMPTDVLFESNR 354-869: Missing. | ||||||
| Isoform D (identifier: P51797-4) Also known as: ClC-6d; D1-A2; The sequence of this isoform differs from the canonical sequence as follows: 237-308: DKRDFVSAGA...QFGSWGSFQL → SGCWSCCSFR...APWIAELWRV 309-869: Missing. | ||||||
| Isoform E (identifier: P51797-5) The sequence of this isoform differs from the canonical sequence as follows: 844-869: IVGIITRHNLTYEFLQARLRQHYQTI → VSEAPALPPP...LHLRRDLRIR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 869 | 869 | Chloride transport protein 6 | PRO_0000094449 | |||||
Regions | |||||||||
| Topological domain | 1 – 80 | 80 | Cytoplasmic By similarity | ||||||
| Transmembrane | 81 – 113 | 33 | Helical; By similarity | ||||||
| Transmembrane | 128 – 150 | 23 | Helical; By similarity | ||||||
| Intramembrane | 159 – 166 | 8 | Helical; By similarity | ||||||
| Transmembrane | 176 – 194 | 19 | Helical; By similarity | ||||||
| Transmembrane | 200 – 217 | 18 | Helical; By similarity | ||||||
| Intramembrane | 241 – 253 | 13 | Helical; By similarity | ||||||
| Intramembrane | 257 – 265 | 9 | Helical; By similarity | ||||||
| Transmembrane | 277 – 294 | 18 | Helical; By similarity | ||||||
| Transmembrane | 335 – 364 | 30 | Helical; By similarity | ||||||
| Transmembrane | 371 – 392 | 22 | Helical; By similarity | ||||||
| Transmembrane | 462 – 481 | 20 | Helical; By similarity | ||||||
| Transmembrane | 487 – 511 | 25 | Helical; By similarity | ||||||
| Intramembrane | 519 – 533 | 15 | Helical; By similarity | ||||||
| Intramembrane | 534 – 536 | 3 | Note=Loop between two helices; By similarity | ||||||
| Intramembrane | 537 – 548 | 12 | Helical; By similarity | ||||||
| Intramembrane | 549 – 552 | 4 | Note=Loop between two helices; By similarity | ||||||
| Transmembrane | 553 – 571 | 19 | Helical; By similarity | ||||||
| Topological domain | 572 – 869 | 298 | Cytoplasmic By similarity | ||||||
| Domain | 605 – 662 | 58 | CBS 1 | ||||||
| Domain | 807 – 868 | 62 | CBS 2 | ||||||
| Nucleotide binding | 630 – 632 | 3 | ATP By similarity | ||||||
| Nucleotide binding | 849 – 852 | 4 | ATP By similarity | ||||||
| Motif | 156 – 160 | 5 | Selectivity filter part_1 By similarity | ||||||
| Motif | 198 – 202 | 5 | Selectivity filter part_2 By similarity | ||||||
| Motif | 487 – 491 | 5 | Selectivity filter part_3 By similarity | ||||||
| Compositional bias | 4 – 18 | 15 | Cys-rich | ||||||
Sites | |||||||||
| Binding site | 157 | 1 | Chloride By similarity | ||||||
| Binding site | 489 | 1 | Chloride; via amide nitrogen By similarity | ||||||
| Binding site | 576 | 1 | Chloride By similarity | ||||||
| Site | 200 | 1 | Mediates proton transfer from the outer aqueous phase to the interior of the protein; involved in linking H(+) and Cl(-) transport By similarity | ||||||
| Site | 267 | 1 | Mediates proton transfer from the protein to the inner aqueous phase By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 410 | 1 | N-linked (GlcNAc...) | ||||||
| Glycosylation | 422 | 1 | N-linked (GlcNAc...) | ||||||
| Glycosylation | 432 | 1 | N-linked (GlcNAc...) | ||||||
Natural variations | |||||||||
| Alternative sequence | 237 – 320 | 84 | DKRDF…EFKCS → YGKRQERLCISRSGCWSCCS FRGANRGYLVQSRGGFVLLE PRAHVESALLFHVCHLHPQL LPFWDSVWKLGFLPAPWIAE LWRV in isoform B. | VSP_001043 | |||||
| Alternative sequence | 237 – 308 | 72 | DKRDF…GSFQL → SGCWSCCSFRGANRGYLVQS RGGFVLLEPRAHVESALLFH VCHLHPQLLPFWDSVWKLGF LPAPWIAELWRV in isoform D. | VSP_001047 | |||||
| Alternative sequence | 309 – 869 | 561 | Missing in isoform D. | VSP_001048 | |||||
| Alternative sequence | 319 – 353 | 35 | CSDSD…ATFNC → SLREPPCVSGNHRGGVCGLD GVRRMPTDVLFESNR in isoform C. | VSP_001045 | |||||
| Alternative sequence | 321 – 869 | 549 | Missing in isoform B. | VSP_001044 | |||||
| Alternative sequence | 354 – 869 | 516 | Missing in isoform C. | VSP_001046 | |||||
| Alternative sequence | 844 – 869 | 26 | IVGII…HYQTI → VSEAPALPPPLREDPLARCC LCTQASHQKRRHPTRRGECG PTLALNPARLPCTRDPFPCL PADGTSVPLAVLSSQSRAST RLCLPPEMLLFTPYHWCSLV LHLRRDLRIR in isoform E. | VSP_017188 | |||||
| Natural variant | 198 | 1 | E → G. Ref.1 Ref.2 Ref.3 Ref.4 Ref.6 Ref.8 Ref.9 Corresponds to variant rs198400 [ dbSNP | Ensembl ]. | VAR_023051 | |||||
Experimental info | |||||||||
| Mutagenesis | 410 | 1 | N → A: Abolishes N-glycosylation; when associated with A-422 and A-432. Ref.11 | ||||||
| Mutagenesis | 422 | 1 | N → A: Abolishes N-glycosylation; when associated with A-410 and A-432. Ref.11 | ||||||
| Mutagenesis | 432 | 1 | N → A: Abolishes N-glycosylation; when associated with A-410 and A-422. Ref.11 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "ClC-6 and ClC-7 are two novel broadly expressed members of the CLC chloride channel family." Brandt S., Jentsch T.J. FEBS Lett. 377:15-20(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), TISSUE SPECIFICITY, VARIANT GLY-198. Tissue: Brain. |
| [2] | "Alternative splicing of ClC-6 (a member of the ClC chloride-channel family) transcripts generates three truncated isoforms one of which, ClC-6c, is kidney-specific." Eggermont J., Buyse G., Voets T., Tytgat J., De Smedt H., Droogmans G., Nilius B. Biochem. J. 325:269-276(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS B; C AND D), NUCLEOTIDE SEQUENCE [MRNA] OF 1-409 (ISOFORM A), TISSUE SPECIFICITY, VARIANT GLY-198. Tissue: Chronic myeloid leukemia cell. |
| [3] | "Complete genomic structure of the CLCN6 and CLCN7 putative chloride channel genes." Kornak U., Boesl M.R., Kubisch C. Biochim. Biophys. Acta 1447:100-106(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM A), VARIANT GLY-198. |
| [4] | "Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1." Nomura N., Nagase T., Miyajima N., Sazuka T., Tanaka A., Sato S., Seki N., Kawarabayasi Y., Ishikawa K., Tabata S. DNA Res. 1:223-229(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A), VARIANT GLY-198. Tissue: Bone marrow. |
| [5] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A), VARIANT GLY-198. Tissue: Hippocampus. |
| [7] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLY-198. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A), VARIANT GLY-198. Tissue: Brain. |
| [10] | "Expression of CLCN voltage-gated chloride channel genes in human blood vessels." Lamb F.S., Clayton G.H., Liu B.-X., Smith R.L., Barna T.J., Schutte B.C. J. Mol. Cell. Cardiol. 31:657-666(1999) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. Tissue: Aortic endothelium and Vascular smooth muscle. |
| [11] | "Human ClC-6 is a late endosomal glycoprotein that associates with detergent-resistant lipid domains." Ignoul S., Simaels J., Hermans D., Annaert W., Eggermont J. PLoS ONE 2:E474-E474(2007) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, GLYCOSYLATION, MUTAGENESIS OF ASN-410; ASN-422 AND ASN-432. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X83378 mRNA. Translation: CAA58292.1. X96391 mRNA. Translation: CAA65255.1. X99472 Genomic DNA. Translation: CAA67835.1. X99473 mRNA. Translation: CAA67836.1. X99474 mRNA. Translation: CAA67837.1. X99475 mRNA. Translation: CAA67838.1. AF009257 AF009256 Genomic DNA. Translation: AAB69287.1.D28475 mRNA. Translation: BAA05836.4. AK289999 mRNA. Translation: BAF82688.1. AL953897, AL021155 Genomic DNA. Translation: CAI15891.1. AL953897, AL021155 Genomic DNA. Translation: CAI15892.1. AL953897, AL021155 Genomic DNA. Translation: CAI15893.1. AL953897, AL021155 Genomic DNA. Translation: CAI15894.1. AL953897, AL021155 Genomic DNA. Translation: CAI15895.1. AL021155, AL953897 Genomic DNA. Translation: CAI23402.1. AL021155, AL953897 Genomic DNA. Translation: CAI23403.1. AL021155, AL953897 Genomic DNA. Translation: CAI23404.1. AL021155, AL953897 Genomic DNA. Translation: CAI23405.1. AL021155, AL953897 Genomic DNA. Translation: CAI23406.1. CH471130 Genomic DNA. Translation: EAW71715.1. BC117420 mRNA. Translation: AAI17421.1. BC117424 mRNA. Translation: AAI17425.1. |
| IPI | IPI00180121. IPI00305252. IPI00395741. IPI00414669. IPI00642888. |
| PIR | S68428. |
| RefSeq | NP_001277.1. NM_001286.3. |
| UniGene | Hs.193043. |
3D structure databases | |
| ProteinModelPortal | P51797. |
| SMR | P51797. Positions 87-639. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P51797. |
Polymorphism databases | |
| DMDM | 311033364. |
Proteomic databases | |
| PaxDb | P51797. |
| PRIDE | P51797. |
Protocols and materials databases | |
| DNASU | 1185. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000312413; ENSP00000308367; ENSG00000011021. ENST00000346436; ENSP00000234488; ENSG00000011021. ENST00000376496; ENSP00000365679; ENSG00000011021. |
| GeneID | 1185. |
| KEGG | hsa:1185. |
| UCSC | uc001ate.4. human. uc009vnf.1. human. uc009vng.1. human. uc009vnh.1. human. |
Organism-specific databases | |
| CTD | 1185. |
| GeneCards | GC01P011866. |
| HGNC | HGNC:2024. CLCN6. |
| HPA | HPA032097. |
| MIM | 602726. gene. |
| neXtProt | NX_P51797. |
| PharmGKB | PA26551. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0038. |
| HOVERGEN | HBG050985. |
| KO | K05015. |
| OMA | TEVEMDK. |
| OrthoDB | EOG4N5VW7. |
| PhylomeDB | P51797. |
Gene expression databases | |
| ArrayExpress | P51797. |
| Bgee | P51797. |
| Genevestigator | P51797. |
Family and domain databases | |
| Gene3D | 1.10.3080.10. 2 hits. |
| InterPro | IPR014743. Cl-channel_core. IPR001807. Cl-channel_volt-gated. IPR002248. Cl_channel-6. IPR000644. Cysta_beta_synth_core. [Graphical view] |
| Pfam | PF00571. CBS. 2 hits. PF00654. Voltage_CLC. 1 hit. [Graphical view] |
| PRINTS | PR00762. CLCHANNEL. PR01117. CLCHANNEL6. |
| SMART | SM00116. CBS. 2 hits. [Graphical view] |
| SUPFAM | SSF81340. Cl-channel_core. 1 hit. |
| PROSITE | PS51371. CBS. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CLCN6. human. |
| GenomeRNAi | 1185. |
| NextBio | 4898. |
| SOURCE | Search... |
Entry information
| Entry name | CLCN6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P51797 Secondary accession number(s): A8K1T4 Q99429 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
