Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Chloride transport protein 6

Gene

CLCN6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Chloride transport protein, initially identified as voltage-gated chloride channel. The presence of the conserved gating glutamate residues suggests that is functions as antiporter.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei157ChlorideBy similarity1
Sitei200Mediates proton transfer from the outer aqueous phase to the interior of the protein; involved in linking H(+) and Cl(-) transportBy similarity1
Sitei267Mediates proton transfer from the protein to the inner aqueous phaseBy similarity1
Binding sitei489Chloride; via amide nitrogenBy similarity1
Binding sitei576ChlorideBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi630 – 632ATPBy similarity3
Nucleotide bindingi849 – 852ATPBy similarity4

GO - Molecular functioni

GO - Biological processi

  • cell volume homeostasis Source: UniProtKB
  • chloride transmembrane transport Source: GO_Central
  • chloride transport Source: UniProtKB
  • ion transmembrane transport Source: Reactome
  • response to mechanical stimulus Source: Ensembl
  • signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Antiport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Chloride, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000011021-MONOMER.
ReactomeiR-HSA-2672351. Stimuli-sensing channels.
R-HSA-6802952. Signaling by BRAF and RAF fusions.

Names & Taxonomyi

Protein namesi
Recommended name:
Chloride transport protein 6
Alternative name(s):
Chloride channel protein 6
Short name:
ClC-6
Gene namesi
Name:CLCN6
Synonyms:KIAA0046
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:2024. CLCN6.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 80CytoplasmicBy similarityAdd BLAST80
Transmembranei81 – 113HelicalBy similarityAdd BLAST33
Transmembranei128 – 150HelicalBy similarityAdd BLAST23
Intramembranei159 – 166HelicalBy similarity8
Transmembranei176 – 194HelicalBy similarityAdd BLAST19
Transmembranei200 – 217HelicalBy similarityAdd BLAST18
Intramembranei241 – 253HelicalBy similarityAdd BLAST13
Intramembranei257 – 265HelicalBy similarity9
Transmembranei277 – 294HelicalBy similarityAdd BLAST18
Transmembranei335 – 364HelicalBy similarityAdd BLAST30
Transmembranei371 – 392HelicalBy similarityAdd BLAST22
Transmembranei462 – 481HelicalBy similarityAdd BLAST20
Transmembranei487 – 511HelicalBy similarityAdd BLAST25
Intramembranei519 – 533HelicalBy similarityAdd BLAST15
Intramembranei534 – 536Note=Loop between two helicesBy similarity3
Intramembranei537 – 548HelicalBy similarityAdd BLAST12
Intramembranei549 – 552Note=Loop between two helicesBy similarity4
Transmembranei553 – 571HelicalBy similarityAdd BLAST19
Topological domaini572 – 869CytoplasmicBy similarityAdd BLAST298

GO - Cellular componenti

  • endosome membrane Source: Reactome
  • integral component of membrane Source: UniProtKB
  • lysosomal membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi410N → A: Abolishes N-glycosylation; when associated with A-422 and A-432. 1 Publication1
Mutagenesisi422N → A: Abolishes N-glycosylation; when associated with A-410 and A-432. 1 Publication1
Mutagenesisi432N → A: Abolishes N-glycosylation; when associated with A-410 and A-422. 1 Publication1

Organism-specific databases

DisGeNETi1185.
OpenTargetsiENSG00000011021.
PharmGKBiPA26551.

Chemistry databases

GuidetoPHARMACOLOGYi705.

Polymorphism and mutation databases

BioMutaiCLCN6.
DMDMi311033364.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000944491 – 869Chloride transport protein 6Add BLAST869

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi410N-linked (GlcNAc...)1 Publication1
Glycosylationi422N-linked (GlcNAc...)1 Publication1
Glycosylationi432N-linked (GlcNAc...)1 Publication1
Modified residuei773PhosphoserineBy similarity1

Post-translational modificationi

N-glycosylated on several asparagine residues.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiP51797.
MaxQBiP51797.
PaxDbiP51797.
PeptideAtlasiP51797.
PRIDEiP51797.

PTM databases

iPTMnetiP51797.
PhosphoSitePlusiP51797.
SwissPalmiP51797.

Expressioni

Tissue specificityi

Testis, ovary, small intestine, brain and skeletal muscle. Low level expression in aortic and coronary vascular smooth muscle cells, and aortic endothelial cells. Isoform 3 is only detected in kidney.3 Publications

Gene expression databases

BgeeiENSG00000011021.
ExpressionAtlasiP51797. baseline and differential.
GenevisibleiP51797. HS.

Organism-specific databases

HPAiHPA032097.

Interactioni

Protein-protein interaction databases

BioGridi107599. 4 interactors.
IntActiP51797. 1 interactor.
STRINGi9606.ENSP00000234488.

Structurei

3D structure databases

ProteinModelPortaliP51797.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini605 – 662CBS 1PROSITE-ProRule annotationAdd BLAST58
Domaini807 – 868CBS 2PROSITE-ProRule annotationAdd BLAST62

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi156 – 160Selectivity filter part_1By similarity5
Motifi198 – 202Selectivity filter part_2By similarity5
Motifi487 – 491Selectivity filter part_3By similarity5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi4 – 18Cys-richAdd BLAST15

Sequence similaritiesi

Contains 2 CBS domains.PROSITE-ProRule annotation

Keywords - Domaini

CBS domain, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0474. Eukaryota.
COG0038. LUCA.
GeneTreeiENSGT00760000119109.
HOVERGENiHBG050985.
InParanoidiP51797.
KOiK05015.
OMAiESMDNKK.
OrthoDBiEOG091G01HL.
PhylomeDBiP51797.
TreeFamiTF313867.

Family and domain databases

Gene3Di1.10.3080.10. 2 hits.
InterProiIPR000644. CBS_dom.
IPR014743. Cl-channel_core.
IPR001807. Cl-channel_volt-gated.
IPR002248. Cl_channel-6.
[Graphical view]
PfamiPF00571. CBS. 2 hits.
PF00654. Voltage_CLC. 1 hit.
[Graphical view]
PRINTSiPR00762. CLCHANNEL.
PR01117. CLCHANNEL6.
SMARTiSM00116. CBS. 2 hits.
[Graphical view]
SUPFAMiSSF81340. SSF81340. 2 hits.
PROSITEiPS51371. CBS. 2 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P51797-1) [UniParc]FASTAAdd to basket
Also known as: A, Clc-6a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGCRGSLCC CCRWCCCCGE RETRTPEELT ILGETQEEED EILPRKDYES
60 70 80 90 100
LDYDRCINDP YLEVLETMDN KKGRRYEAVK WMVVFAIGVC TGLVGLFVDF
110 120 130 140 150
FVRLFTQLKF GVVQTSVEEC SQKGCLALSL LELLGFNLTF VFLASLLVLI
160 170 180 190 200
EPVAAGSGIP EVKCYLNGVK VPGIVRLRTL LCKVLGVLFS VAGGLFVEKE
210 220 230 240 250
GPMIHSGSVV GAGLPQFQSI SLRKIQFNFP YFRSDRDKRD FVSAGAAAGV
260 270 280 290 300
AAAFGAPIGG TLFSLEEGSS FWNQGLTWKV LFCSMSATFT LNFFRSGIQF
310 320 330 340 350
GSWGSFQLPG LLNFGEFKCS DSDKKCHLWT AMDLGFFVVM GVIGGLLGAT
360 370 380 390 400
FNCLNKRLAK YRMRNVHPKP KLVRVLESLL VSLVTTVVVF VASMVLGECR
410 420 430 440 450
QMSSSSQIGN DSFQLQVTED VNSSIKTFFC PNDTYNDMAT LFFNPQESAI
460 470 480 490 500
LQLFHQDGTF SPVTLALFFV LYFLLACWTY GISVPSGLFV PSLLCGAAFG
510 520 530 540 550
RLVANVLKSY IGLGHIYSGT FALIGAAAFL GGVVRMTISL TVILIESTNE
560 570 580 590 600
ITYGLPIMVT LMVAKWTGDF FNKGIYDIHV GLRGVPLLEW ETEVEMDKLR
610 620 630 640 650
ASDIMEPNLT YVYPHTRIQS LVSILRTTVH HAFPVVTENR GNEKEFMKGN
660 670 680 690 700
QLISNNIKFK KSSILTRAGE QRKRSQSMKS YPSSELRNMC DEHIASEEPA
710 720 730 740 750
EKEDLLQQML ERRYTPYPNL YPDQSPSEDW TMEERFRPLT FHGLILRSQL
760 770 780 790 800
VTLLVRGVCY SESQSSASQP RLSYAEMAED YPRYPDIHDL DLTLLNPRMI
810 820 830 840 850
VDVTPYMNPS PFTVSPNTHV SQVFNLFRTM GLRHLPVVNA VGEIVGIITR
860
HNLTYEFLQA RLRQHYQTI
Length:869
Mass (Da):97,289
Last modified:November 2, 2010 - v2
Checksum:iD625F0C2189EB6F7
GO
Isoform 2 (identifier: P51797-2) [UniParc]FASTAAdd to basket
Also known as: B, ClC-6b, D2-A1

The sequence of this isoform differs from the canonical sequence as follows:
     237-320: DKRDFVSAGA...LLNFGEFKCS → YGKRQERLCI...APWIAELWRV
     321-869: Missing.

Show »
Length:320
Mass (Da):36,006
Checksum:i68604EBB1B15E8CA
GO
Isoform 3 (identifier: P51797-3) [UniParc]FASTAAdd to basket
Also known as: C, ClC-6c, D1-A1

The sequence of this isoform differs from the canonical sequence as follows:
     319-353: CSDSDKKCHLWTAMDLGFFVVMGVIGGLLGATFNC → SLREPPCVSGNHRGGVCGLDGVRRMPTDVLFESNR
     354-869: Missing.

Show »
Length:353
Mass (Da):38,814
Checksum:i078D3E8A2C013E94
GO
Isoform 4 (identifier: P51797-4) [UniParc]FASTAAdd to basket
Also known as: D, ClC-6d, D1-A2

The sequence of this isoform differs from the canonical sequence as follows:
     237-308: DKRDFVSAGA...QFGSWGSFQL → SGCWSCCSFR...APWIAELWRV
     309-869: Missing.

Show »
Length:308
Mass (Da):34,515
Checksum:i60C3293CAC95D6BE
GO
Isoform 5 (identifier: P51797-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     844-869: IVGIITRHNLTYEFLQARLRQHYQTI → VSEAPALPPP...LHLRRDLRIR

Note: No experimental confirmation available.
Show »
Length:953
Mass (Da):106,376
Checksum:i5503065172532131
GO
Isoform 6 (identifier: P51797-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-71: Missing.

Note: No experimental confirmation available.
Show »
Length:847
Mass (Da):94,660
Checksum:i00E66C8453C4B6F6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti19G → S in BAG57898 (PubMed:14702039).Curated1
Sequence conflicti92G → D in BAG57898 (PubMed:14702039).Curated1
Sequence conflicti442F → S in BAG57898 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_023051198E → G.7 PublicationsCorresponds to variant rs198400dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04716950 – 71Missing in isoform 6. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_001043237 – 320DKRDF…EFKCS → YGKRQERLCISRSGCWSCCS FRGANRGYLVQSRGGFVLLE PRAHVESALLFHVCHLHPQL LPFWDSVWKLGFLPAPWIAE LWRV in isoform 2. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_001047237 – 308DKRDF…GSFQL → SGCWSCCSFRGANRGYLVQS RGGFVLLEPRAHVESALLFH VCHLHPQLLPFWDSVWKLGF LPAPWIAELWRV in isoform 4. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_001048309 – 869Missing in isoform 4. 1 PublicationAdd BLAST561
Alternative sequenceiVSP_001045319 – 353CSDSD…ATFNC → SLREPPCVSGNHRGGVCGLD GVRRMPTDVLFESNR in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_001044321 – 869Missing in isoform 2. 1 PublicationAdd BLAST549
Alternative sequenceiVSP_001046354 – 869Missing in isoform 3. 1 PublicationAdd BLAST516
Alternative sequenceiVSP_017188844 – 869IVGII…HYQTI → VSEAPALPPPLREDPLARCC LCTQASHQKRRHPTRRGECG PTLALNPARLPCTRDPFPCL PADGTSVPLAVLSSQSRAST RLCLPPEMLLFTPYHWCSLV LHLRRDLRIR in isoform 5. CuratedAdd BLAST26

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X83378 mRNA. Translation: CAA58292.1.
X96391 mRNA. Translation: CAA65255.1.
X99472 Genomic DNA. Translation: CAA67835.1.
X99473 mRNA. Translation: CAA67836.1.
X99474 mRNA. Translation: CAA67837.1.
X99475 mRNA. Translation: CAA67838.1.
AF009257
, AF009247, AF009248, AF009249, AF009250, AF009251, AF009252, AF009253, AF009254, AF009255, AF009256 Genomic DNA. Translation: AAB69287.1.
D28475 mRNA. Translation: BAA05836.4.
AK289999 mRNA. Translation: BAF82688.1.
AK294764 mRNA. Translation: BAG57898.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15891.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15892.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15893.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15894.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15895.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23402.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23403.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23404.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23405.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23406.1.
CH471130 Genomic DNA. Translation: EAW71715.1.
BC117420 mRNA. Translation: AAI17421.1.
BC117424 mRNA. Translation: AAI17425.1.
CCDSiCCDS138.1. [P51797-1]
CCDS57972.1. [P51797-6]
PIRiS68428.
RefSeqiNP_001243888.1. NM_001256959.1.
NP_001277.1. NM_001286.3.
UniGeneiHs.193043.

Genome annotation databases

EnsembliENST00000312413; ENSP00000308367; ENSG00000011021. [P51797-6]
ENST00000346436; ENSP00000234488; ENSG00000011021. [P51797-1]
ENST00000376496; ENSP00000365679; ENSG00000011021. [P51797-5]
GeneIDi1185.
KEGGihsa:1185.
UCSCiuc001ate.6. human. [P51797-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X83378 mRNA. Translation: CAA58292.1.
X96391 mRNA. Translation: CAA65255.1.
X99472 Genomic DNA. Translation: CAA67835.1.
X99473 mRNA. Translation: CAA67836.1.
X99474 mRNA. Translation: CAA67837.1.
X99475 mRNA. Translation: CAA67838.1.
AF009257
, AF009247, AF009248, AF009249, AF009250, AF009251, AF009252, AF009253, AF009254, AF009255, AF009256 Genomic DNA. Translation: AAB69287.1.
D28475 mRNA. Translation: BAA05836.4.
AK289999 mRNA. Translation: BAF82688.1.
AK294764 mRNA. Translation: BAG57898.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15891.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15892.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15893.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15894.1.
AL953897, AL021155 Genomic DNA. Translation: CAI15895.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23402.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23403.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23404.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23405.1.
AL021155, AL953897 Genomic DNA. Translation: CAI23406.1.
CH471130 Genomic DNA. Translation: EAW71715.1.
BC117420 mRNA. Translation: AAI17421.1.
BC117424 mRNA. Translation: AAI17425.1.
CCDSiCCDS138.1. [P51797-1]
CCDS57972.1. [P51797-6]
PIRiS68428.
RefSeqiNP_001243888.1. NM_001256959.1.
NP_001277.1. NM_001286.3.
UniGeneiHs.193043.

3D structure databases

ProteinModelPortaliP51797.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107599. 4 interactors.
IntActiP51797. 1 interactor.
STRINGi9606.ENSP00000234488.

Chemistry databases

GuidetoPHARMACOLOGYi705.

PTM databases

iPTMnetiP51797.
PhosphoSitePlusiP51797.
SwissPalmiP51797.

Polymorphism and mutation databases

BioMutaiCLCN6.
DMDMi311033364.

Proteomic databases

EPDiP51797.
MaxQBiP51797.
PaxDbiP51797.
PeptideAtlasiP51797.
PRIDEiP51797.

Protocols and materials databases

DNASUi1185.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000312413; ENSP00000308367; ENSG00000011021. [P51797-6]
ENST00000346436; ENSP00000234488; ENSG00000011021. [P51797-1]
ENST00000376496; ENSP00000365679; ENSG00000011021. [P51797-5]
GeneIDi1185.
KEGGihsa:1185.
UCSCiuc001ate.6. human. [P51797-1]

Organism-specific databases

CTDi1185.
DisGeNETi1185.
GeneCardsiCLCN6.
HGNCiHGNC:2024. CLCN6.
HPAiHPA032097.
MIMi602726. gene.
neXtProtiNX_P51797.
OpenTargetsiENSG00000011021.
PharmGKBiPA26551.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0474. Eukaryota.
COG0038. LUCA.
GeneTreeiENSGT00760000119109.
HOVERGENiHBG050985.
InParanoidiP51797.
KOiK05015.
OMAiESMDNKK.
OrthoDBiEOG091G01HL.
PhylomeDBiP51797.
TreeFamiTF313867.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000011021-MONOMER.
ReactomeiR-HSA-2672351. Stimuli-sensing channels.
R-HSA-6802952. Signaling by BRAF and RAF fusions.

Miscellaneous databases

ChiTaRSiCLCN6. human.
GeneWikiiCLCN6.
GenomeRNAii1185.
PROiP51797.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000011021.
ExpressionAtlasiP51797. baseline and differential.
GenevisibleiP51797. HS.

Family and domain databases

Gene3Di1.10.3080.10. 2 hits.
InterProiIPR000644. CBS_dom.
IPR014743. Cl-channel_core.
IPR001807. Cl-channel_volt-gated.
IPR002248. Cl_channel-6.
[Graphical view]
PfamiPF00571. CBS. 2 hits.
PF00654. Voltage_CLC. 1 hit.
[Graphical view]
PRINTSiPR00762. CLCHANNEL.
PR01117. CLCHANNEL6.
SMARTiSM00116. CBS. 2 hits.
[Graphical view]
SUPFAMiSSF81340. SSF81340. 2 hits.
PROSITEiPS51371. CBS. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCLCN6_HUMAN
AccessioniPrimary (citable) accession number: P51797
Secondary accession number(s): A8K1T4
, B4DGT7, F8W9R3, O60818, O60819, O60820, O60821, P78520, P78521, Q17R81, Q5SNW2, Q5SNW3, Q5SNX1, Q5SNX2, Q5SNX3, Q99427, Q99428, Q99429
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 2, 2010
Last modified: November 30, 2016
This is version 158 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The CLC channel family contains both chloride channels and proton-coupled anion transporters that exchange chloride or another anion for protons. The presence of conserved gating glutamate residues is typical for family members that function as antiporters (By similarity).By similarity

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.