P51795 (CLCN5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 128.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: H(+)/Cl(-) exchange transporter 5 Alternative name(s): Chloride channel protein 5 Short name=ClC-5 Chloride transporter ClC-5 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 746 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Proton-coupled chloride transporter. Functions as antiport system and exchanges chloride ions against protons. Important for normal acidification of the endosome lumen. May play an important role in renal tubular function. |
| Subunit structure | Interacts with NEDD4 and NEDD4L. Ref.8 |
| Subcellular location | Golgi apparatus membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein Ref.22. |
| Tissue specificity | Kidney. Moderately expressed in aortic vascular smooth muscle and endothelial cells, and at a slightly higher level in the coronary vascular smooth muscle. Ref.7 |
| Post-translational modification | Ubiquitinated by NEDD4L in the presence of albumin; which promotes endocytosis and proteasomal degradation. Ref.8 |
| Involvement in disease | Hypophosphatemic rickets, X-linked recessive (XLRHR) [MIM:300554]: A renal disease belonging to the 'Dent disease complex', a group of disorders characterized by proximal renal tubular defect, hypercalciuria, nephrocalcinosis, and renal insufficiency. The spectrum of phenotypic features is remarkably similar in the various disorders, except for differences in the severity of bone deformities and renal impairment. XLRH patients present with rickets or osteomalacia, hypophosphatemia due to decreased renal tubular phosphate reabsorption, hypercalciuria, and low molecular weight proteinuria. Patients develop nephrocalcinosis with progressive renal failure in adulthood. Female carriers may have asymptomatic hypercalciuria or hypophosphatemia only. Nephrolithiasis 2 (NPHL2) [MIM:300009]: An X-linked recessive renal disease belonging to the 'Dent disease complex', a group of disorders characterized by proximal renal tubular defect, hypercalciuria, nephrocalcinosis, and renal insufficiency. The spectrum of phenotypic features is remarkably similar in the various disorders, except for differences in the severity of bone deformities and renal impairment. Nephrolithiasis type 2 patients manifest hypercalciuria, hypophosphatemia, aminoaciduria, nephrocalcinosis and nephrolithiasis, renal insufficiency leading to renal failure in adulthood, rickets (33% of patients) and osteomalacia. Nephrolithiasis 1 (NPHL1) [MIM:310468]: An X-linked recessive renal disease belonging to the 'Dent disease complex', a group of disorders characterized by proximal renal tubular defect, hypercalciuria, nephrocalcinosis and renal insufficiency. The spectrum of phenotypic features is remarkably similar in the various disorders, except for differences in the severity of bone deformities and renal impairment. Nephrolithiasis type 1 presents with hypercalciuria, nephrocalcinosis, renal stones and renal insufficiency. Patients lack urinary acidification defects, rickets, and osteomalacia. Low molecular weight proteinuria with hypercalciuria and nephrocalcinosis (LMWPHN) [MIM:308990]: An X-linked renal disease belonging to the 'Dent disease complex', a group of disorders characterized by proximal renal tubular defect, hypercalciuria, nephrocalcinosis, and renal insufficiency. The spectrum of phenotypic features is remarkably similar in the various disorders, except for differences in the severity of bone deformities and renal impairment. LMWPHN is a slowly progressive disorder. Patients tend to have hypercalciuric nephrocalcinosis without rickets or renal failure. |
| Miscellaneous | The CLC channel family contains both chloride channels and proton-coupled anion transporters that exchange chloride or another anion for protons. The absence of conserved gating glutamate residues is typical for family members that function as channels. |
| Sequence similarities | Belongs to the chloride channel (TC 2.A.49) family. ClC-5/CLCN5 subfamily. [View classification] Contains 2 CBS domains. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P51795-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P51795-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAMWQGAMDNRGFQQGSFSSFQNSSSDEDLMDIPATAMDFSMRDDVPPLDREVGEDKSYNGGGIGSSNRIM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 746 | 746 | H(+)/Cl(-) exchange transporter 5 | PRO_0000094446 | |||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||
| Topological domain | 1 – 54 | 54 | Cytoplasmic By similarity | ||||||||||||||||||||||||||||||||||||
| Transmembrane | 55 – 92 | 38 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Transmembrane | 138 – 161 | 24 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Intramembrane | 170 – 177 | 8 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Transmembrane | 186 – 205 | 20 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Transmembrane | 211 – 230 | 20 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Intramembrane | 242 – 254 | 13 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Intramembrane | 258 – 266 | 9 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Transmembrane | 278 – 296 | 19 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Transmembrane | 319 – 345 | 27 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Transmembrane | 352 – 372 | 21 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Transmembrane | 428 – 448 | 21 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Transmembrane | 453 – 472 | 20 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Intramembrane | 500 – 514 | 15 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Intramembrane | 515 – 517 | 3 | Note=Loop between two helices; By similarity | ||||||||||||||||||||||||||||||||||||
| Intramembrane | 518 – 529 | 12 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Intramembrane | 530 – 534 | 5 | Note=Loop between two helices; By similarity | ||||||||||||||||||||||||||||||||||||
| Transmembrane | 535 – 552 | 18 | Helical; By similarity | ||||||||||||||||||||||||||||||||||||
| Topological domain | 553 – 746 | 194 | Cytoplasmic By similarity | ||||||||||||||||||||||||||||||||||||
| Domain | 586 – 650 | 65 | CBS 1 | ||||||||||||||||||||||||||||||||||||
| Domain | 682 – 742 | 61 | CBS 2 | ||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 617 – 619 | 3 | ATP | ||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 724 – 727 | 4 | ATP | ||||||||||||||||||||||||||||||||||||
| Motif | 167 – 171 | 5 | Selectivity filter part_1 By similarity | ||||||||||||||||||||||||||||||||||||
| Motif | 209 – 213 | 5 | Selectivity filter part_2 By similarity | ||||||||||||||||||||||||||||||||||||
| Motif | 453 – 457 | 5 | Selectivity filter part_3 By similarity | ||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||
| Binding site | 168 | 1 | Chloride By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 455 | 1 | Chloride; via amide nitrogen By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 558 | 1 | Chloride By similarity | ||||||||||||||||||||||||||||||||||||
| Binding site | 596 | 1 | ATP; via amide nitrogen and carbonyl oxygen | ||||||||||||||||||||||||||||||||||||
| Site | 211 | 1 | Mediates proton transfer from the outer aqueous phase to the interior of the protein; involved in linking H(+) and Cl(-) transport By similarity | ||||||||||||||||||||||||||||||||||||
| Site | 268 | 1 | Mediates proton transfer from the protein to the inner aqueous phase By similarity | ||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MAMWQGAMDNRGFQQGSFSS FQNSSSDEDLMDIPATAMDF SMRDDVPPLDREVGEDKSYN GGGIGSSNRIM in isoform 2. | VSP_042046 | |||||||||||||||||||||||||||||||||||
| Natural variant | 30 | 1 | R → RH in NPHL2. Ref.12 | VAR_001615 | |||||||||||||||||||||||||||||||||||
| Natural variant | 57 | 1 | G → V in NPHL2; alters targeting to endosomes. Ref.12 Ref.14 Ref.22 | VAR_001616 | |||||||||||||||||||||||||||||||||||
| Natural variant | 142 | 1 | M → I. Corresponds to variant rs34800648 [ dbSNP | Ensembl ]. | VAR_048694 | |||||||||||||||||||||||||||||||||||
| Natural variant | 179 | 1 | G → D in NPHL2; retained in the endoplasmic reticulum; improperly N-glycosylated and non-functional. Ref.23 | VAR_065591 | |||||||||||||||||||||||||||||||||||
| Natural variant | 200 | 1 | L → R in NPHL2; retained in the endoplasmic reticulum; improperly N-glycosylated and non-functional. Ref.10 Ref.23 | VAR_001617 | |||||||||||||||||||||||||||||||||||
| Natural variant | 203 | 1 | S → L in NPHL2; retained in the endoplasmic reticulum; improperly N-glycosylated and non-functional. Ref.23 | VAR_065592 | |||||||||||||||||||||||||||||||||||
| Natural variant | 212 | 1 | G → A in NPHL2; trafficks normally to the cell surface and to early endosomes; endergoes complex glycosylation at the cell surface like wild-type protein but exhibits significant reductions in outwardly rectifying ion currents. Ref.23 | VAR_065593 | |||||||||||||||||||||||||||||||||||
| Natural variant | 219 | 1 | C → R in NPHL2; retained in the endoplasmic reticulum; improperly N-glycosylated and non-functional. Ref.21 Ref.23 | VAR_065594 | |||||||||||||||||||||||||||||||||||
| Natural variant | 221 | 1 | C → R in NPHL2; retained in the endoplasmic reticulum; improperly N-glycosylated and non-functional. Ref.17 Ref.23 | VAR_065595 | |||||||||||||||||||||||||||||||||||
| Natural variant | 225 | 1 | L → P in NPHL2; retained in the endoplasmic reticulum; improperly N-glycosylated and non-functional. Ref.24 | VAR_065596 | |||||||||||||||||||||||||||||||||||
| Natural variant | 244 | 1 | S → L in XLRHR; trafficks normally to the cell surface and to early endosomes; displays complex glycosylation at the cell surface like wild-type protein; exhibits reduced current. Ref.10 Ref.11 Ref.17 Ref.19 Ref.20 Ref.24 | VAR_001618 | |||||||||||||||||||||||||||||||||||
| Natural variant | 260 | 1 | G → V in NPHL2; delayed in processing of the protein and decrease in the stability of the mature complex glycosylated form causing lower cell surface expression; the early endosome distribution is normal; shows abolished current at the plasma membrane. Ref.18 Ref.19 Ref.20 Ref.24 | VAR_065597 | |||||||||||||||||||||||||||||||||||
| Natural variant | 267 | 1 | E → A in NPHL2. Ref.17 | VAR_065598 | |||||||||||||||||||||||||||||||||||
| Natural variant | 267 | 1 | Missing in NPHL2. Ref.19 | VAR_065599 | |||||||||||||||||||||||||||||||||||
| Natural variant | 270 | 1 | S → G in NPHL2. Ref.17 | VAR_065600 | |||||||||||||||||||||||||||||||||||
| Natural variant | 270 | 1 | S → R in NPHL2; retained in the endoplasmic reticulum; alters protein stability; associated with an abolishment of chloride current. Ref.15 Ref.22 | VAR_065601 | |||||||||||||||||||||||||||||||||||
| Natural variant | 272 | 1 | Y → C in NPHL2; trafficks normally to the cell surface and to early endosomes and displays complex glycosylation at the cell surface like wild-type protein; exhibits no current. Ref.19 Ref.24 | VAR_065602 | |||||||||||||||||||||||||||||||||||
| Natural variant | 273 | 1 | F → L in NPHL2. Ref.21 | VAR_065603 | |||||||||||||||||||||||||||||||||||
| Natural variant | 278 | 1 | L → F in NPHL2; associated with a marked reduction to about 30% of wild-type chloride currents; no significant differences between the expression of the mutated and wild-type protein. Ref.15 Ref.24 | VAR_065604 | |||||||||||||||||||||||||||||||||||
| Natural variant | 280 | 1 | R → P in LMWPHN; 70% reduction in chloride transport activity and alters targeting to endosomes. Ref.13 Ref.22 | VAR_001619 | |||||||||||||||||||||||||||||||||||
| Natural variant | 340 | 1 | N → K in NPHL2; retained in the endoplasmic reticulum; improperly N-glycosylated and non-functional. Ref.19 Ref.24 | VAR_065605 | |||||||||||||||||||||||||||||||||||
| Natural variant | 462 | 1 | G → D in NPHL2. Ref.17 | VAR_065606 | |||||||||||||||||||||||||||||||||||
| Natural variant | 469 | 1 | L → P in NPHL2; retained in the endoplasmic reticulum; improperly N-glycosylated and non-functional. Ref.23 | VAR_065607 | |||||||||||||||||||||||||||||||||||
| Natural variant | 506 | 1 | G → E in NPHL1. Ref.10 | VAR_001620 | |||||||||||||||||||||||||||||||||||
| Natural variant | 512 | 1 | G → R in NPHL2; abolishes the chloride currents. Ref.12 | VAR_001621 | |||||||||||||||||||||||||||||||||||
| Natural variant | 513 | 1 | G → E in NPHL2; causes retention in the endoplasmic reticulum and alters protein stability; total loss of function. Ref.22 | VAR_065608 | |||||||||||||||||||||||||||||||||||
| Natural variant | 513 | 1 | G → R in NPHL2. Ref.17 Ref.24 | VAR_065609 | |||||||||||||||||||||||||||||||||||
| Natural variant | 516 | 1 | R → W in NPHL2; causes retention in the endoplasmic reticulum and alters protein stability; total loss of function. Ref.17 Ref.22 | VAR_065610 | |||||||||||||||||||||||||||||||||||
| Natural variant | 520 | 1 | S → P in NPHL2. Ref.10 | VAR_001622 | |||||||||||||||||||||||||||||||||||
| Natural variant | 524 | 1 | I → K in LMWPHN; causes retention in the endoplasmic reticulum and alters protein stability; total loss of function. Ref.16 Ref.22 | VAR_065611 | |||||||||||||||||||||||||||||||||||
| Natural variant | 527 | 1 | E → D in NPHL2; abolishes the chloride currents; total loss of function. Ref.12 Ref.22 | VAR_001623 | |||||||||||||||||||||||||||||||||||
| Natural variant | 545 | 1 | S → N in NPHL2. Ref.17 | VAR_065612 | |||||||||||||||||||||||||||||||||||
| Natural variant | 546 | 1 | K → E in NPHL2; delayed in processing of the protein and decrease in the stability of the mature complex glycosylated form causing lower cell surface expression; the early endosome distribution is normal; shows abolished current at the plasma membrane. Ref.17 Ref.24 | VAR_065613 | |||||||||||||||||||||||||||||||||||
| Natural variant | 547 | 1 | W → G in NPHL2; delayed in processing of the protein and decrease in the stability of the mature complex glycosylated form causing lower cell surface expression; the early endosome distribution is normal; shows reduced current at the plasma membrane. Ref.21 Ref.24 | VAR_065614 | |||||||||||||||||||||||||||||||||||
| Natural variant | 657 | 1 | T → S in NPHL2. Ref.17 | VAR_065615 | |||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 211 | 1 | E → A: Abolishes proton transport, but not chloride transport. Ref.9 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 617 | 1 | Y → A: Strongly decreased affinity for ATP, but no effect on chloride transport. Ref.9 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 618 | 1 | S → A: No effect ATP binding or chloride transport. Ref.9 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 672 | 1 | Y → A: Abolishes interaction with NEDD4 and NEDD4L. Ref.8 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 727 | 1 | D → A: Strongly decreased affinity for ATP, but no effect on chloride transport. Ref.9 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 732 | 1 | I → V in BAG51748. Ref.2 | ||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||
| Helix | 582 – 585 | 4 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 586 – 588 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 598 – 601 | 4 | |||||||||||||||||||||||||||||||||||||
| Helix | 605 – 614 | 10 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 618 – 624 | 7 | |||||||||||||||||||||||||||||||||||||
| Turn | 626 – 628 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 630 – 636 | 7 | |||||||||||||||||||||||||||||||||||||
| Helix | 637 – 648 | 12 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 659 – 661 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 663 – 665 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 680 – 682 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 683 – 686 | 4 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 689 – 691 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 696 – 706 | 11 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 709 – 715 | 7 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 718 – 724 | 7 | |||||||||||||||||||||||||||||||||||||
| Helix | 725 – 735 | 11 | |||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of CLCN5, the human kidney chloride channel gene implicated in Dent disease (an X-linked hereditary nephrolithiasis)." Fisher S.E., van Bakel I., Lloyd S.E., Pearce S.H.S., Thakker R.V., Craig I.W. Genomics 29:598-606(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Kidney. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Isolation and partial characterization of a chloride channel gene which is expressed in kidney and is a candidate for Dent's disease (an X-linked hereditary nephrolithiasis)." Fisher S., Black G.C.M., Lloyd S.E., Hatchwell E., Wrong O., Thakker R.V., Craig I.W. Hum. Mol. Genet. 3:2053-2059(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 487-746. Tissue: Kidney. |
| [6] | "Four additional CLCN5 exons encode a widely expressed novel long CLC-5 isoform but fail to explain Dent's phenotype in patients without mutations in the short variant." Ludwig M., Waldegger S., Nuutinen M., Bokenkamp A., Reissinger A., Steckelbroeck S., Utsch B. Kidney Blood Press. Res. 26:176-184(2003) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION (ISOFORM 2), ALTERNATIVE SPLICING. |
| [7] | "Expression of CLCN voltage-gated chloride channel genes in human blood vessels." Lamb F.S., Clayton G.H., Liu B.-X., Smith R.L., Barna T.J., Schutte B.C. J. Mol. Cell. Cardiol. 31:657-666(1999) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. Tissue: Aortic endothelium and Vascular smooth muscle. |
| [8] | "Nedd4-2 functionally interacts with ClC-5: involvement in constitutive albumin endocytosis in proximal tubule cells." Hryciw D.H., Ekberg J., Lee A., Lensink I.L., Kumar S., Guggino W.B., Cook D.I., Pollock C.A., Poronnik P. J. Biol. Chem. 279:54996-55007(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NEDD4 AND NEDD4L, UBIQUITINATION, MUTAGENESIS OF TYR-672. |
| [9] | "Nucleotide recognition by the cytoplasmic domain of the human chloride transporter ClC-5." Meyer S., Savaresi S., Forster I.C., Dutzler R. Nat. Struct. Mol. Biol. 14:60-67(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 570-746 IN COMPLEXES WITH ATP AND ADP, MUTAGENESIS OF GLU-211; TYR-617; SER-618 AND ASP-727. |
| [10] | "A common molecular basis for three inherited kidney stone diseases." Lloyd S.E., Pearce S.H.S., Fisher S.E., Steinmeyer K., Schwappach B., Schelnman S.J., Harding B., Bolino A., Devoto M., Goodyer P., Rigden S.P.A., Wrong O., Jentsch T.J., Craig I.W., Thakker R.V. Nature 379:445-449(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT XLRHR LEU-244, VARIANT NPHL1 GLU-506, VARIANTS NPHL2 ARG-200 AND PRO-520. |
| [11] | "A second family with XLRH displays the mutation S244L in the CLCN5 gene." Oudet C., Martin-Coignard D., Pannetier S., Praud E., Champion G., Hanauer A. Hum. Genet. 99:781-784(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT NPHL2 LEU-244. |
| [12] | "Characterisation of renal chloride channel, CLCN5, mutations in hypercalciuric nephrolithiasis (kidney stones) disorders." Lloyd S.E., Guenther W., Pearce S.H.S., Thomson A., Bianchi M.L., Bosio M., Craig I.W., Fisher S.E., Scheinman S.J., Wrong O., Jentsch T.J., Thakker R.V. Hum. Mol. Genet. 6:1233-1239(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NPHL2 HIS-30 INS; VAL-57; ARG-512 AND ASP-527. |
| [13] | "Idiopathic low molecular weight proteinuria associated with hypercalciuric nephrocalcinosis in Japanese children is due to mutations of the renal chloride channel (CLCN5)." Lloyd S.E., Pearce S.H.S., Guenther W., Kawaguchi H., Igarashi T., Jentsch T.J., Thakker R.V. J. Clin. Invest. 99:967-974(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LMWPHN PRO-280. |
| [14] | "X-linked recessive nephrolithiasis: presentation and diagnosis in children." Schurman S.J., Norden A.G., Scheinman S.J. J. Pediatr. 132:859-862(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT NPHL2 VAL-57. |
| [15] | "Functional characterization of renal chloride channel, CLCN5, mutations associated with Dent'sJapan disease." Igarashi T., Gunther W., Sekine T., Inatomi J., Shiraga H., Takahashi S., Suzuki J., Tsuru N., Yanagihara T., Shimazu M., Jentsch T.J., Thakker R.V. Kidney Int. 54:1850-1856(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NPHL2 ARG-270 AND PHE-278, CHARACTERIZATION OF VARIANTS NPHL2 ARG-270 AND PHE-278. |
| [16] | "Identification of two novel mutations in the CLCN5 gene in Japanese patients with familial idiopathic low molecular weight proteinuria (Japanese Dent's disease)." Takemura T., Hino S., Ikeda M., Okada M., Igarashi T., Inatomi J., Yoshioka K. Am. J. Kidney Dis. 37:138-143(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LMWPHN LYS-524. |
| [17] | "Evidence for genetic heterogeneity in Dent's disease." Hoopes R.R. Jr., Raja K.M., Koich A., Hueber P., Reid R., Knohl S.J., Scheinman S.J. Kidney Int. 65:1615-1620(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NPHL2 ARG-221; LEU-244; ALA-267; GLY-270; ASP-462; ARG-513; TRP-516; ASN-545; GLU-546 AND SER-657. |
| [18] | "Dent's disease and prevalence of renal stones in dialysis patients in Northeastern Italy." Tosetto E., Graziotto R., Artifoni L., Nachtigal J., Cascone C., Conz P., Piva M., Dell'Aquila R., De Paoli Vitali E., Citron L., Nalesso F., Antonello A., Vertolli U., Zagatti R., Lupo A., D'Angelo A., Anglani F., Gambaro G. J. Hum. Genet. 51:25-30(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT NPHL2 VAL-260. |
| [19] | "Phenotypic and genetic heterogeneity in Dent's disease -- the results of an Italian collaborative study." Tosetto E., Ghiggeri G.M., Emma F., Barbano G., Carrea A., Vezzoli G., Torregrossa R., Cara M., Ripanti G., Ammenti A., Peruzzi L., Murer L., Ratsch I.M., Citron L., Gambaro G., D'angelo A., Anglani F. Nephrol. Dial. Transplant. 21:2452-2463(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NPHL2 LEU-244; VAL-260; GLU-267 DEL; CYS-272 AND LYS-340. |
| [20] | "Family history may be misleading in the diagnosis of Dent's disease." Anglani F., Bernich P., Tosetto E., Cara M., Lupo A., Nalesso F., D'Angelo A., Gambaro G. Urol. Res. 34:61-63(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NPHL2 LEU-244 AND VAL-260. |
| [21] | "A missense mutation in the chloride/proton ClC-5 antiporter gene results in increased expression of an alternative mRNA form that lacks exons 10 and 11. Identification of seven new CLCN5 mutations in patients with Dent's disease." Ramos-Trujillo E., Gonzalez-Acosta H., Flores C., Garcia-Nieto V., Guillen E., Gracia S., Vicente C., Espinosa L., Maseda M.A., Santos F., Camacho J.A., Claverie-Martin F. J. Hum. Genet. 52:255-261(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NPHL2 ARG-219; LEU-273 AND GLY-547. |
| [22] | "Characterization of Dent's disease mutations of CLC-5 reveals a correlation between functional and cell biological consequences and protein structure." Smith A.J., Reed A.A., Loh N.Y., Thakker R.V., Lippiat J.D. Am. J. Physiol. 296:F390-F397(2009) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS NPHL2 VAL-57; ARG-270; GLU-513; TRP-516 AND ASP-527, CHARACTERIZATION OF VARIANTS LMWPHN PRO-280 AND LYS-524, SUBCELLULAR LOCATION. |
| [23] | "Novel CLCN5 mutations in patients with Dent's disease result in altered ion currents or impaired exchanger processing." Grand T., Mordasini D., L'Hoste S., Pennaforte T., Genete M., Biyeyeme M.J., Vargas-Poussou R., Blanchard A., Teulon J., Lourdel S. Kidney Int. 76:999-1005(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS NPHL2 ASP-179; LEU-203; ALA-212 AND PRO-469, CHARACTERIZATION OF VARIANTS NPHL2 ASP-179; ARG-200; LEU-203; ALA-212; ARG-219; ARG-221 AND PRO-469. |
| [24] | "Heterogeneity in the processing of CLCN5 mutants related to Dent disease." Grand T., L'Hoste S., Mordasini D., Defontaine N., Keck M., Pennaforte T., Genete M., Laghmani K., Teulon J., Lourdel S. Hum. Mutat. 32:476-483(2011) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS NPHL2 PRO-225; VAL-260; CYS-272; PHE-278; LYS-340; ARG-513; GLU-546 AND GLY-547, CHARACTERIZATION OF VARIANT XLRHR LEU-244. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X91906 mRNA. Translation: CAA63000.1. AK056560 mRNA. Translation: BAG51748.1. AL663118 Genomic DNA. Translation: CAI41555.1. BC130429 mRNA. Translation: AAI30430.1. BC130431 mRNA. Translation: AAI30432.1. X81836 mRNA. Translation: CAA57430.1. BK000969 mRNA. Translation: DAA01544.1. | ||||||||||||||||||
| IPI | IPI00294056. | ||||||||||||||||||
| PIR | I37277. | ||||||||||||||||||
| RefSeq | NP_000075.1. NM_000084.3. NP_001121370.1. NM_001127898.2. NP_001121371.1. NM_001127899.2. | ||||||||||||||||||
| UniGene | Hs.166486. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P51795. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-29263N. | ||||||||||||||||||
| STRING | 9606.ENSP00000365256. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 1705908. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P51795. | ||||||||||||||||||
| PRIDE | P51795. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 1184. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000307367; ENSP00000304257; ENSG00000171365. ENST00000376088; ENSP00000365256; ENSG00000171365. ENST00000376091; ENSP00000365259; ENSG00000171365. ENST00000376108; ENSP00000365276; ENSG00000171365. ENST00000594930; ENSP00000470026; ENSG00000269240. ENST00000598870; ENSP00000469532; ENSG00000269240. ENST00000600725; ENSP00000470125; ENSG00000269240. ENST00000601418; ENSP00000471330; ENSG00000269240. | ||||||||||||||||||
| GeneID | 1184. | ||||||||||||||||||
| KEGG | hsa:1184. | ||||||||||||||||||
| UCSC | uc004dos.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 1184. | ||||||||||||||||||
| GeneCards | GC0XP049687. | ||||||||||||||||||
| HGNC | HGNC:2023. CLCN5. | ||||||||||||||||||
| HPA | HPA000401. | ||||||||||||||||||
| MIM | 300008. gene. 300009. phenotype. 300554. phenotype. 308990. phenotype. 310468. phenotype. | ||||||||||||||||||
| neXtProt | NX_P51795. | ||||||||||||||||||
| Orphanet | 93622. Dent disease type 1. | ||||||||||||||||||
| PharmGKB | PA26550. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG0038. | ||||||||||||||||||
| HOGENOM | HOG000164493. | ||||||||||||||||||
| HOVERGEN | HBG050984. | ||||||||||||||||||
| InParanoid | P51795. | ||||||||||||||||||
| KO | K05014. | ||||||||||||||||||
| OMA | SYNGGGI. | ||||||||||||||||||
| OrthoDB | EOG4XD3QH. | ||||||||||||||||||
| PhylomeDB | P51795. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| Bgee | P51795. | ||||||||||||||||||
| CleanEx | HS_CLCN5. | ||||||||||||||||||
| Genevestigator | P51795. | ||||||||||||||||||
| GermOnline | ENSG00000171365. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.10.3080.10. 3 hits. | ||||||||||||||||||
| InterPro | IPR014743. Cl-channel_core. IPR001807. Cl-channel_volt-gated. IPR002247. Cl_channel-5. IPR000644. Cysta_beta_synth_core. [Graphical view] | ||||||||||||||||||
| Pfam | PF00571. CBS. 2 hits. PF00654. Voltage_CLC. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00762. CLCHANNEL. PR01116. CLCHANNEL5. | ||||||||||||||||||
| SMART | SM00116. CBS. 2 hits. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF81340. Cl-channel_core. 1 hit. | ||||||||||||||||||
| PROSITE | PS51371. CBS. 2 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | P51795. | ||||||||||||||||||
| GenomeRNAi | 1184. | ||||||||||||||||||
| NextBio | 4894. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | CLCN5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P51795 Secondary accession number(s): A1L475 Q7RTN8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
