P51575 Q9UK84 P2RX1_HUMAN P2X purinoceptor 1 P2X1 ATP receptor Purinergic receptor P2RX1 P2X1 Homo sapiens Human Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Characterization and chromosomal localization of a human P2X receptor from the urinary bladder. NUCLEOTIDE SEQUENCE [MRNA] Urinary bladder smooth muscle The human P2x1 receptor: molecular cloning, tissue distribution, and localization to chromosome 17. NUCLEOTIDE SEQUENCE [MRNA] Urinary bladder P2X1 purinoceptor in human platelets. Molecular cloning and functional characterization after heterologous expression. NUCLEOTIDE SEQUENCE [MRNA] Platelet The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] Blood Regulation of human P2X1 promoter by bHLH factors in smooth muscle cells. NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-8 Placenta Conserved cysteine residues in the extracellular loop of the human P2X(1) receptor form disulfide bonds and are involved in receptor trafficking to the cell surface. DISULFIDE BONDS A natural dominant negative P2X1 receptor due to deletion of a single amino acid residue. VARIANT BLEEDING DISORDER LEU-351 DEL Ligand gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Seems to be linked to apoptosis, by increasing the intracellular concentration of calcium in the presence of ATP, leading to programmed cell death (By similarity). Homo- or heteropolymers (By similarity). Membrane Multi-pass membrane protein Defects in P2RX1 are a cause of bleeding disorder [MIM:600845]. Belongs to the P2X receptor family. P2X receptor entry P2RX1 entry Apoptosis Complete proteome Disease mutation Disulfide bond Glycoprotein Ion transport Ionic channel Membrane Polymorphism Receptor Transmembrane Transport M V MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSG LISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEH PEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLR EAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESG QNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVEN GTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKR HYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License