P51572 (BAP31_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: B-cell receptor-associated protein 31 Short name=BCR-associated protein 31 Short name=Bap31 Alternative name(s): 6C6-AG tumor-associated antigen Protein CDM p28 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 246 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis. Ref.10 Ref.11 |
| Subunit structure | Homodimer and heterodimer with BCAP29. Binds CASP8 (isoform 9) as a complex containing BCAP31, BCAP29, BCL2 and/or BCL2L1. Interacts with VAMP3, VAMP1 and membrane IgD immunoglobulins. May interact with ACTG1 and non-muscle myosin II. Interacts with PTPLB. Ref.9 Ref.12 Ref.13 |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Note: May shuttle between the ER and the intermediate compartment/cis-Golgi complex. Ref.9 Ref.10 |
| Tissue specificity | Ubiquitous. |
| Post-translational modification | Cleaved by CASP8 and other caspases. |
| Involvement in disease | BCAP31 is deleted in the chromosome Xq28 deletion syndrome which involves BCAP31 and the and the promoter region of ABCD1. |
| Sequence similarities | Belongs to the BCAP29/BCAP31 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BCL2 | P10415 | 2 | EBI-77683,EBI-77694 | |
| CASP8 | Q14790 | 3 | EBI-77683,EBI-78060 | |
| CFTR | P13569 | 3 | EBI-77683,EBI-349854 | |
| DERL1 | Q9BUN8 | 3 | EBI-77683,EBI-398977 | |
| FIS1 | Q9Y3D6 | 8 | EBI-77683,EBI-3385283 | |
| PTPLB | Q6Y1H2 | 4 | EBI-77683,EBI-530257 | |
| SEC61B | P60468 | 7 | EBI-77683,EBI-1788819 | |
| TRAM1 | Q15629 | 5 | EBI-77683,EBI-1788852 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P51572-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P51572-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGAEASSSWCPGTALPEERLSVKRASEISGFLGQGSSGEAALDVLTHVLEGAGNKLTSSCGKPSSNRM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.9 | ||||||
| Chain | 2 – 246 | 245 | B-cell receptor-associated protein 31 | PRO_0000142891 | |||||
Regions | |||||||||
| Topological domain | 2 – 6 | 5 | Lumenal Potential | ||||||
| Transmembrane | 7 – 27 | 21 | Helical; Potential | ||||||
| Topological domain | 28 – 43 | 16 | Cytoplasmic Potential | ||||||
| Transmembrane | 44 – 64 | 21 | Helical; Potential | ||||||
| Topological domain | 65 – 102 | 38 | Lumenal Potential | ||||||
| Transmembrane | 103 – 123 | 21 | Helical; Potential | ||||||
| Topological domain | 124 – 246 | 123 | Cytoplasmic Potential | ||||||
| Motif | 243 – 246 | 4 | Di-lysine motif | ||||||
Sites | |||||||||
| Site | 164 – 165 | 2 | Cleavage; by caspase-8 Potential | ||||||
| Site | 238 – 239 | 2 | Cleavage; by caspase-8 Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MGAEASSSWCPGTALPEERL SVKRASEISGFLGQGSSGEA ALDVLTHVLEGAGNKLTSSC GKPSSNRM in isoform 2. | VSP_043116 | |||||
Experimental info | |||||||||
| Mutagenesis | 164 | 1 | D → A: Abolishes cleavage by caspases, inhibits apoptotic membrane blebbing and release of cytochrome c from mitochondria; when associated with A-238. Ref.11 | ||||||
| Mutagenesis | 238 | 1 | D → A: Abolishes cleavage by caspases, inhibits apoptotic membrane blebbing and release of cytochrome c from mitochondria; when associated with A-164. Ref.11 | ||||||
| Sequence conflict | 2 | 1 | S → T in CAA57415. Ref.3 | ||||||
| Sequence conflict | 72 | 1 | K → E in AAH14323. Ref.7 | ||||||
| Sequence conflict | 208 | 1 | Q → E in CAA57415. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A new human gene (DXS1357E) with ubiquitous expression, located in Xq28 adjacent to the adrenoleukodystrophy gene." Mosser J., Sarde C.-O., Vicaire S., Yates J.R., Mandel J.-L. Genomics 22:469-471(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Molecular cloning and characterization of a transmembrane surface antigen in human cells." Li E., Bestagno M., Burrone O. Eur. J. Biochem. 238:631-638(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "The specificity of association of the IgD molecule with the accessory proteins BAP31/BAP29 lies in the IgD transmembrane sequence." Adachi T., Schamel W.W.A., Kim K.-M., Watanabe T., Becker B., Nielsen P.J., Reth M. EMBO J. 15:1534-1541(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: B-cell and Promyelocytic leukemia. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Stomach and Trachea. |
| [5] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Pancreas. |
| [8] | Eichler E.E., Lu F., Shen Y., Muzny D.M., Gibbs R.A., Nelson D.L. Submitted (OCT-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 121-246. |
| [9] | "p28 Bap31, a Bcl-2/Bcl-XL- and procaspase-8-associated protein in the endoplasmic reticulum." Ng F.W.H., Nguyen M., Kwan T., Branton P.E., Nicholson D.W., Cromlish J.A., Shore G.C. J. Cell Biol. 139:327-338(1997) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-11, SUBCELLULAR LOCATION, INTERACTION WITH BCL2; BCL2L1 AND CASP8. |
| [10] | "Export of cellubrevin from the endoplasmic reticulum is controlled by BAP31." Annaert W.G., Becker B., Kistner U., Reth M., Jahn R. J. Cell Biol. 139:1397-1410(1997) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 80-96 AND 205-214, SUBCELLULAR LOCATION, FUNCTION. |
| [11] | "Caspase-resistant BAP31 inhibits Fas-mediated apoptotic membrane fragmentation and release of cytochrome c from mitochondria." Nguyen M., Breckenridge D.G., Ducret A., Shore G.C. Mol. Cell. Biol. 20:6731-6740(2000) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF ASP-164 AND ASP-238, ROLE IN APOPTOSIS. |
| [12] | "The procaspase-8 isoform, procaspase-8L, recruited to the BAP31 complex at the endoplasmic reticulum." Breckenridge D.G., Nguyen M., Kuppig S., Reth M., Shore G.C. Proc. Natl. Acad. Sci. U.S.A. 99:4331-4336(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CASP8 ISOFORM 9. |
| [13] | "The yeast split-ubiquitin membrane protein two-hybrid screen identifies BAP31 as a regulator of the turnover of endoplasmic reticulum-associated protein tyrosine phosphatase-like B." Wang B., Pelletier J., Massaad M.J., Herscovics A., Shore G.C. Mol. Cell. Biol. 24:2767-2778(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PTPLB. |
| [14] | "Contiguous deletion of the X-linked adrenoleukodystrophy gene (ABCD1) and DXS1357E: a novel neonatal phenotype similar to peroxisomal biogenesis disorders." Corzo D., Gibson W., Johnson K., Mitchell G., LePage G., Cox G.F., Casey R., Zeiss C., Tyson H., Cutting G.R., Raymond G.V., Smith K.D., Watkins P.A., Moser A.B., Moser H.W., Steinberg S.J. Am. J. Hum. Genet. 70:1520-1531(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN CONTIGUOUS ABCD1/DXS1375E DELETION SYNDROME. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Z31696 mRNA. Translation: CAA83501.1. X81109 mRNA. Translation: CAA57015.1. X81817 mRNA. Translation: CAA57415.1. AK057613 mRNA. Translation: BAG51941.1. AK125631 mRNA. Translation: BAG54226.1. U52111 Genomic DNA. No translation available. CH471172 Genomic DNA. Translation: EAW72818.1. CH471172 Genomic DNA. Translation: EAW72819.1. CH471172 Genomic DNA. Translation: EAW72820.1. CH471172 Genomic DNA. Translation: EAW72821.1. CH471172 Genomic DNA. Translation: EAW72823.1. CH471172 Genomic DNA. Translation: EAW72824.1. CH471172 Genomic DNA. Translation: EAW72825.1. BC014323 mRNA. Translation: AAH14323.1. BC065292 mRNA. Translation: AAH65292.1. U36341 Genomic DNA. Translation: AAA79508.1. |
| IPI | IPI00218200. |
| PIR | S44279. |
| RefSeq | NP_001132913.1. NM_001139441.1. NP_001132929.1. NM_001139457.2. NP_001243376.1. NM_001256447.1. NP_005736.3. NM_005745.7. |
| UniGene | Hs.522817. |
3D structure databases | |
| ProteinModelPortal | P51572. |
| SMR | P51572. Positions 175-214. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P51572. 20 interactions. |
| MINT | MINT-3018869. |
| STRING | 9606.ENSP00000392330. |
Protein family/group databases | |
| TCDB | 3.A.5.9.1. general secretory pathway (Sec) family. |
PTM databases | |
| PhosphoSite | P51572. |
Polymorphism databases | |
| DMDM | 1705725. |
Proteomic databases | |
| PaxDb | P51572. |
| PRIDE | P51572. |
Protocols and materials databases | |
| DNASU | 10134. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000345046; ENSP00000343458; ENSG00000185825. ENST00000441714; ENSP00000405417; ENSG00000185825. ENST00000458587; ENSP00000392330; ENSG00000185825. ENST00000596601; ENSP00000473146; ENSG00000267977. ENST00000597329; ENSP00000472030; ENSG00000267977. ENST00000600824; ENSP00000472405; ENSG00000267977. |
| GeneID | 10134. |
| KEGG | hsa:10134. |
| UCSC | uc004fid.2. human. uc004fie.2. human. |
Organism-specific databases | |
| CTD | 10134. |
| GeneCards | GC0XM152965. |
| HGNC | HGNC:16695. BCAP31. |
| HPA | CAB015350. CAB015424. HPA003906. |
| MIM | 300398. gene. |
| neXtProt | NX_P51572. |
| PharmGKB | PA128394569. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG244998. |
| HOGENOM | HOG000204790. |
| HOVERGEN | HBG050661. |
| InParanoid | P51572. |
| KO | K14009. |
| OMA | SYGNTFF. |
| OrthoDB | EOG405S2D. |
| PhylomeDB | P51572. |
Enzyme and pathway databases | |
| Reactome | REACT_578. Apoptosis. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | P51572. |
| Bgee | P51572. |
| CleanEx | HS_BCAP31. |
| Genevestigator | P51572. |
| GermOnline | ENSG00000185825. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008417. Bap31. [Graphical view] |
| PANTHER | PTHR12701. PTHR12701. 1 hit. |
| Pfam | PF05529. Bap31. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BCAP31. human. |
| GenomeRNAi | 10134. |
| NextBio | 38337. |
| PMAP-CutDB | P51572. |
| SOURCE | Search... |
Entry information
| Entry name | BAP31_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P51572 Secondary accession number(s): B3KQ79 Q96CF0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
