Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P51178

- PLCD1_HUMAN

UniProt

P51178 - PLCD1_HUMAN

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1

Gene

PLCD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 153 (01 Oct 2014)
      Sequence version 2 (23 Sep 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. Essential for trophoblast and placental development.

    Catalytic activityi

    1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

    Cofactori

    Binds 3 calcium ions per subunit. Two of the calcium ions are bound to the C2 domain By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei311 – 3111PROSITE-ProRule annotation
    Metal bindingi312 – 3121Calcium 1; catalyticBy similarity
    Metal bindingi341 – 3411Calcium 1; catalyticBy similarity
    Metal bindingi343 – 3431Calcium 1; catalyticBy similarity
    Active sitei356 – 3561PROSITE-ProRule annotation
    Metal bindingi390 – 3901Calcium 1; catalyticBy similarity
    Binding sitei438 – 4381SubstrateBy similarity
    Binding sitei440 – 4401SubstrateBy similarity
    Binding sitei522 – 5221SubstrateBy similarity
    Binding sitei549 – 5491SubstrateBy similarity
    Metal bindingi651 – 6511Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi653 – 6531Calcium 2By similarity
    Metal bindingi677 – 6771Calcium 2By similarity
    Metal bindingi706 – 7061Calcium 3By similarity
    Metal bindingi707 – 7071Calcium 3; via carbonyl oxygenBy similarity
    Metal bindingi708 – 7081Calcium 3By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi153 – 164121PROSITE-ProRule annotationAdd
    BLAST
    Calcium bindingi189 – 200122PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. GTPase activating protein binding Source: BHF-UCL
    3. phosphatidylinositol phospholipase C activity Source: ProtInc
    4. signal transducer activity Source: UniProtKB-KW

    GO - Biological processi

    1. angiogenesis Source: Ensembl
    2. inositol phosphate metabolic process Source: Reactome
    3. intracellular signal transduction Source: InterPro
    4. labyrinthine layer blood vessel development Source: Ensembl
    5. lipid catabolic process Source: UniProtKB-KW
    6. phospholipid metabolic process Source: ProtInc
    7. regulation of cell proliferation Source: Ensembl
    8. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Hydrolase, Transducer

    Keywords - Biological processi

    Lipid degradation, Lipid metabolism

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS07195-MONOMER.
    ReactomeiREACT_150312. Synthesis of IP3 and IP4 in the cytosol.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 (EC:3.1.4.11)
    Alternative name(s):
    Phosphoinositide phospholipase C-delta-1
    Phospholipase C-III
    Short name:
    PLC-III
    Phospholipase C-delta-1
    Short name:
    PLC-delta-1
    Gene namesi
    Name:PLCD1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:9060. PLCD1.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: MGI
    2. cytosol Source: Ensembl
    3. extracellular vesicular exosome Source: UniProt
    4. plasma membrane Source: Reactome

    Pathology & Biotechi

    Involvement in diseasei

    Nail disorder, non-syndromic congenital, 3 (NDNC3) [MIM:151600]: A nail disorder characterized by a white appearance of the nail plate (true leukonychia), the nail bed (pseudoleukonychia), or neither (apparent leukonychia). Leukonychia may involve all of the nail (leukonychia totalis) or only part of the nail (leukonychia partialis), or can appear as one or more transverse bands (leukonychia striata) or white spots (leukonychia punctata).1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti209 – 2091T → R in NDNC3. 1 Publication
    VAR_066399
    Natural varianti574 – 5741I → T in NDNC3. 1 Publication
    VAR_066400

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    MIMi151600. phenotype.
    Orphaneti2387. Leukonychia totalis.
    PharmGKBiPA33388.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 7567561-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1PRO_0000088504Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi191 – 1911O-linked (GlcNAc)By similarity
    Glycosylationi193 – 1931O-linked (GlcNAc)By similarity

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiP51178.
    PaxDbiP51178.
    PRIDEiP51178.

    2D gel databases

    REPRODUCTION-2DPAGEIPI00746030.

    PTM databases

    PhosphoSiteiP51178.

    Expressioni

    Gene expression databases

    BgeeiP51178.
    CleanExiHS_PLCD1.
    GenevestigatoriP51178.

    Organism-specific databases

    HPAiCAB009913.
    HPA020107.
    HPA021677.

    Interactioni

    Protein-protein interaction databases

    BioGridi111349. 6 interactions.
    IntActiP51178. 1 interaction.
    MINTiMINT-107564.
    STRINGi9606.ENSP00000409572.

    Structurei

    3D structure databases

    ProteinModelPortaliP51178.
    SMRiP51178. Positions 12-130, 158-756.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini21 – 130110PHPROSITE-ProRule annotationAdd
    BLAST
    Domaini140 – 17536EF-hand 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini176 – 21136EF-hand 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini296 – 440145PI-PLC X-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini492 – 609118PI-PLC Y-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini616 – 720105C2PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni30 – 5728Substrate bindingBy similarityAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C2 domain.PROSITE-ProRule annotation
    Contains 2 EF-hand domains.PROSITE-ProRule annotation
    Contains 1 PH domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG149692.
    HOGENOMiHOG000006871.
    HOVERGENiHBG053610.
    KOiK05857.
    OMAiTSGQAFY.
    OrthoDBiEOG7V49XT.
    PhylomeDBiP51178.
    TreeFamiTF313216.

    Family and domain databases

    Gene3Di1.10.238.10. 2 hits.
    2.30.29.30. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProiIPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001192. PI-PLC_fam.
    IPR028391. PLC-delta1.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view]
    PANTHERiPTHR10336. PTHR10336. 1 hit.
    PTHR10336:SF80. PTHR10336:SF80. 1 hit.
    PfamiPF00168. C2. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    [Graphical view]
    PRINTSiPR00390. PHPHLIPASEC.
    SMARTiSM00239. C2. 1 hit.
    SM00054. EFh. 2 hits.
    SM00233. PH. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 1 hit.
    PROSITEiPS50004. C2. 1 hit.
    PS00018. EF_HAND_1. 2 hits.
    PS50222. EF_HAND_2. 2 hits.
    PS50003. PH_DOMAIN. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P51178-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDSGRDFLTL HGLQDDEDLQ ALLKGSQLLK VKSSSWRRER FYKLQEDCKT    50
    IWQESRKVMR TPESQLFSIE DIQEVRMGHR TEGLEKFARD VPEDRCFSIV 100
    FKDQRNTLDL IAPSPADAQH WVLGLHKIIH HSGSMDQRQK LQHWIHSCLR 150
    KADKNKDNKM SFKELQNFLK ELNIQVDDSY ARKIFRECDH SQTDSLEDEE 200
    IEAFYKMLTQ RVEIDRTFAE AAGSGETLSV DQLVTFLQHQ QREEAAGPAL 250
    ALSLIERYEP SETAKAQRQM TKDGFLMYLL SADGSAFSLA HRRVYQDMGQ 300
    PLSHYLVSSS HNTYLLEDQL AGPSSTEAYI RALCKGCRCL ELDCWDGPNQ 350
    EPIIYHGYTF TSKILFCDVL RAIRDYAFKA SPYPVILSLE NHCTLEQQRV 400
    MARHLHAILG PMLLNRPLDG VTNSLPSPEQ LKGKILLKGK KLGGLLPPGG 450
    EGGPEATVVS DEDEAAEMED EAVRSRVQHK PKEDKLRLAQ ELSDMVIYCK 500
    SVHFGGFSSP GTPGQAFYEM ASFSENRALR LLQESGNGFV RHNVGHLSRI 550
    YPAGWRTDSS NYSPVEMWNG GCQIVALNFQ TPGPEMDVYQ GRFQDNGACG 600
    YVLKPAFLRD PNGTFNPRAL AQGPWWARKR LNIRVISGQQ LPKVNKNKNS 650
    IVDPKVTVEI HGVSRDVASR QTAVITNNGF NPWWDTEFAF EVVVPDLALI 700
    RFLVEDYDAS SKNDFIGQST IPLNSLKQGY RHVHLMSKNG DQHPSATLFV 750
    KISLQD 756
    Length:756
    Mass (Da):85,665
    Last modified:September 23, 2008 - v2
    Checksum:i6C6FD7F89BA08C83
    GO
    Isoform 2 (identifier: P51178-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MDSGRDFLTLH → MQCLGIRSRSRSRELYLQERSLKVAALNGRRL

    Note: No experimental confirmation available.

    Show »
    Length:777
    Mass (Da):88,135
    Checksum:i6260C76BE397266B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti224 – 2241S → P in AAA73567. (PubMed:7890667)Curated
    Sequence conflicti264 – 2641A → T in AAA73567. (PubMed:7890667)Curated
    Sequence conflicti591 – 5911G → D in AAA73567. (PubMed:7890667)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti209 – 2091T → R in NDNC3. 1 Publication
    VAR_066399
    Natural varianti257 – 2571R → H.
    Corresponds to variant rs933135 [ dbSNP | Ensembl ].
    VAR_046560
    Natural varianti574 – 5741I → T in NDNC3. 1 Publication
    VAR_066400

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1111MDSGRDFLTLH → MQCLGIRSRSRSRELYLQER SLKVAALNGRRL in isoform 2. 1 PublicationVSP_042919Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U09117 mRNA. Translation: AAA73567.1.
    AK090774 mRNA. Translation: BAG52226.1.
    AC144536 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64507.1.
    BC050382 mRNA. Translation: AAH50382.2.
    CCDSiCCDS2671.1. [P51178-1]
    CCDS46793.1. [P51178-2]
    PIRiA55943.
    RefSeqiNP_001124436.1. NM_001130964.1. [P51178-2]
    NP_006216.2. NM_006225.3. [P51178-1]
    UniGeneiHs.80776.

    Genome annotation databases

    EnsembliENST00000334661; ENSP00000335600; ENSG00000187091. [P51178-1]
    ENST00000463876; ENSP00000430344; ENSG00000187091. [P51178-2]
    GeneIDi5333.
    KEGGihsa:5333.
    UCSCiuc003chm.3. human. [P51178-2]
    uc003chn.3. human. [P51178-1]

    Polymorphism databases

    DMDMi206729887.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U09117 mRNA. Translation: AAA73567.1 .
    AK090774 mRNA. Translation: BAG52226.1 .
    AC144536 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64507.1 .
    BC050382 mRNA. Translation: AAH50382.2 .
    CCDSi CCDS2671.1. [P51178-1 ]
    CCDS46793.1. [P51178-2 ]
    PIRi A55943.
    RefSeqi NP_001124436.1. NM_001130964.1. [P51178-2 ]
    NP_006216.2. NM_006225.3. [P51178-1 ]
    UniGenei Hs.80776.

    3D structure databases

    ProteinModelPortali P51178.
    SMRi P51178. Positions 12-130, 158-756.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111349. 6 interactions.
    IntActi P51178. 1 interaction.
    MINTi MINT-107564.
    STRINGi 9606.ENSP00000409572.

    Chemistry

    BindingDBi P51178.
    ChEMBLi CHEMBL3727.

    PTM databases

    PhosphoSitei P51178.

    Polymorphism databases

    DMDMi 206729887.

    2D gel databases

    REPRODUCTION-2DPAGE IPI00746030.

    Proteomic databases

    MaxQBi P51178.
    PaxDbi P51178.
    PRIDEi P51178.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000334661 ; ENSP00000335600 ; ENSG00000187091 . [P51178-1 ]
    ENST00000463876 ; ENSP00000430344 ; ENSG00000187091 . [P51178-2 ]
    GeneIDi 5333.
    KEGGi hsa:5333.
    UCSCi uc003chm.3. human. [P51178-2 ]
    uc003chn.3. human. [P51178-1 ]

    Organism-specific databases

    CTDi 5333.
    GeneCardsi GC03M038023.
    H-InvDB HIX0003175.
    HGNCi HGNC:9060. PLCD1.
    HPAi CAB009913.
    HPA020107.
    HPA021677.
    MIMi 151600. phenotype.
    602142. gene.
    neXtProti NX_P51178.
    Orphaneti 2387. Leukonychia totalis.
    PharmGKBi PA33388.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG149692.
    HOGENOMi HOG000006871.
    HOVERGENi HBG053610.
    KOi K05857.
    OMAi TSGQAFY.
    OrthoDBi EOG7V49XT.
    PhylomeDBi P51178.
    TreeFami TF313216.

    Enzyme and pathway databases

    BioCyci MetaCyc:HS07195-MONOMER.
    Reactomei REACT_150312. Synthesis of IP3 and IP4 in the cytosol.

    Miscellaneous databases

    GeneWikii PLCD1.
    GenomeRNAii 5333.
    NextBioi 20654.
    PROi P51178.
    SOURCEi Search...

    Gene expression databases

    Bgeei P51178.
    CleanExi HS_PLCD1.
    Genevestigatori P51178.

    Family and domain databases

    Gene3Di 1.10.238.10. 2 hits.
    2.30.29.30. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProi IPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001192. PI-PLC_fam.
    IPR028391. PLC-delta1.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view ]
    PANTHERi PTHR10336. PTHR10336. 1 hit.
    PTHR10336:SF80. PTHR10336:SF80. 1 hit.
    Pfami PF00168. C2. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    [Graphical view ]
    PRINTSi PR00390. PHPHLIPASEC.
    SMARTi SM00239. C2. 1 hit.
    SM00054. EFh. 2 hits.
    SM00233. PH. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 1 hit.
    PROSITEi PS50004. C2. 1 hit.
    PS00018. EF_HAND_1. 2 hits.
    PS50222. EF_HAND_2. 2 hits.
    PS50003. PH_DOMAIN. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and identification of amino acid residues of human phospholipase C delta 1 essential for catalysis."
      Cheng H.F., Jiang M.J., Chen C.L., Liu S.M., Wong L.P., Lomasney J.W., King K.
      J. Biol. Chem. 270:5495-5505(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Aorta.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Amygdala.
    3. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    6. "Hereditary leukonychia, or porcelain nails, resulting from mutations in PLCD1."
      Kiuru M., Kurban M., Itoh M., Petukhova L., Shimomura Y., Wajid M., Christiano A.M.
      Am. J. Hum. Genet. 88:839-844(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS NDNC3 ARG-209 AND THR-574.

    Entry informationi

    Entry nameiPLCD1_HUMAN
    AccessioniPrimary (citable) accession number: P51178
    Secondary accession number(s): B3KR14, Q86VN8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: September 23, 2008
    Last modified: October 1, 2014
    This is version 153 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3