Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P51178

- PLCD1_HUMAN

UniProt

P51178 - PLCD1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1

Gene

PLCD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. Essential for trophoblast and placental development.

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Binds 3 calcium ions per subunit. Two of the calcium ions are bound to the C2 domain By similarity.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei311 – 3111PROSITE-ProRule annotation
Metal bindingi312 – 3121Calcium 1; catalyticBy similarity
Metal bindingi341 – 3411Calcium 1; catalyticBy similarity
Metal bindingi343 – 3431Calcium 1; catalyticBy similarity
Active sitei356 – 3561PROSITE-ProRule annotation
Metal bindingi390 – 3901Calcium 1; catalyticBy similarity
Binding sitei438 – 4381SubstrateBy similarity
Binding sitei440 – 4401SubstrateBy similarity
Binding sitei522 – 5221SubstrateBy similarity
Binding sitei549 – 5491SubstrateBy similarity
Metal bindingi651 – 6511Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi653 – 6531Calcium 2By similarity
Metal bindingi677 – 6771Calcium 2By similarity
Metal bindingi706 – 7061Calcium 3By similarity
Metal bindingi707 – 7071Calcium 3; via carbonyl oxygenBy similarity
Metal bindingi708 – 7081Calcium 3By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi153 – 164121PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi189 – 200122PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. GTPase activating protein binding Source: BHF-UCL
  3. phosphatidic acid binding Source: Ensembl
  4. phosphatidylinositol phosphate binding Source: Ensembl
  5. phosphatidylinositol phospholipase C activity Source: ProtInc
  6. phosphatidylserine binding Source: Ensembl
  7. signal transducer activity Source: UniProtKB-KW

GO - Biological processi

  1. angiogenesis Source: Ensembl
  2. inositol phosphate metabolic process Source: Reactome
  3. intracellular signal transduction Source: InterPro
  4. labyrinthine layer blood vessel development Source: Ensembl
  5. lipid catabolic process Source: UniProtKB-KW
  6. phospholipid metabolic process Source: ProtInc
  7. regulation of cell proliferation Source: Ensembl
  8. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS07195-MONOMER.
ReactomeiREACT_150312. Synthesis of IP3 and IP4 in the cytosol.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-delta-1
Phospholipase C-III
Short name:
PLC-III
Phospholipase C-delta-1
Short name:
PLC-delta-1
Gene namesi
Name:PLCD1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:9060. PLCD1.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. cytosol Source: Ensembl
  3. extracellular vesicular exosome Source: UniProt
  4. plasma membrane Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Involvement in diseasei

Nail disorder, non-syndromic congenital, 3 (NDNC3) [MIM:151600]: A nail disorder characterized by a white appearance of the nail plate (true leukonychia), the nail bed (pseudoleukonychia), or neither (apparent leukonychia). Leukonychia may involve all of the nail (leukonychia totalis) or only part of the nail (leukonychia partialis), or can appear as one or more transverse bands (leukonychia striata) or white spots (leukonychia punctata).1 Publication
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti209 – 2091T → R in NDNC3. 1 Publication
VAR_066399
Natural varianti574 – 5741I → T in NDNC3. 1 Publication
VAR_066400

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi151600. phenotype.
Orphaneti2387. Leukonychia totalis.
PharmGKBiPA33388.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 7567561-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1PRO_0000088504Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi191 – 1911O-linked (GlcNAc)By similarity
Glycosylationi193 – 1931O-linked (GlcNAc)By similarity

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiP51178.
PaxDbiP51178.
PRIDEiP51178.

2D gel databases

REPRODUCTION-2DPAGEIPI00746030.

PTM databases

PhosphoSiteiP51178.

Expressioni

Gene expression databases

BgeeiP51178.
CleanExiHS_PLCD1.
GenevestigatoriP51178.

Organism-specific databases

HPAiCAB009913.
HPA020107.
HPA021677.

Interactioni

Protein-protein interaction databases

BioGridi111349. 11 interactions.
IntActiP51178. 1 interaction.
MINTiMINT-107564.
STRINGi9606.ENSP00000409572.

Structurei

3D structure databases

ProteinModelPortaliP51178.
SMRiP51178. Positions 12-130, 158-756.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini21 – 130110PHPROSITE-ProRule annotationAdd
BLAST
Domaini140 – 17536EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini176 – 21136EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini296 – 440145PI-PLC X-boxPROSITE-ProRule annotationAdd
BLAST
Domaini492 – 609118PI-PLC Y-boxPROSITE-ProRule annotationAdd
BLAST
Domaini616 – 720105C2PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni30 – 5728Substrate bindingBy similarityAdd
BLAST

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 2 EF-hand domains.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG149692.
GeneTreeiENSGT00760000118936.
HOGENOMiHOG000006871.
HOVERGENiHBG053610.
InParanoidiP51178.
KOiK05857.
OMAiTSGQAFY.
OrthoDBiEOG7V49XT.
PhylomeDBiP51178.
TreeFamiTF313216.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR028391. PLC-delta1.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF80. PTHR10336:SF80. 1 hit.
PfamiPF00168. C2. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00054. EFh. 2 hits.
SM00233. PH. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 2 hits.
PS50003. PH_DOMAIN. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P51178-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSGRDFLTL HGLQDDEDLQ ALLKGSQLLK VKSSSWRRER FYKLQEDCKT
60 70 80 90 100
IWQESRKVMR TPESQLFSIE DIQEVRMGHR TEGLEKFARD VPEDRCFSIV
110 120 130 140 150
FKDQRNTLDL IAPSPADAQH WVLGLHKIIH HSGSMDQRQK LQHWIHSCLR
160 170 180 190 200
KADKNKDNKM SFKELQNFLK ELNIQVDDSY ARKIFRECDH SQTDSLEDEE
210 220 230 240 250
IEAFYKMLTQ RVEIDRTFAE AAGSGETLSV DQLVTFLQHQ QREEAAGPAL
260 270 280 290 300
ALSLIERYEP SETAKAQRQM TKDGFLMYLL SADGSAFSLA HRRVYQDMGQ
310 320 330 340 350
PLSHYLVSSS HNTYLLEDQL AGPSSTEAYI RALCKGCRCL ELDCWDGPNQ
360 370 380 390 400
EPIIYHGYTF TSKILFCDVL RAIRDYAFKA SPYPVILSLE NHCTLEQQRV
410 420 430 440 450
MARHLHAILG PMLLNRPLDG VTNSLPSPEQ LKGKILLKGK KLGGLLPPGG
460 470 480 490 500
EGGPEATVVS DEDEAAEMED EAVRSRVQHK PKEDKLRLAQ ELSDMVIYCK
510 520 530 540 550
SVHFGGFSSP GTPGQAFYEM ASFSENRALR LLQESGNGFV RHNVGHLSRI
560 570 580 590 600
YPAGWRTDSS NYSPVEMWNG GCQIVALNFQ TPGPEMDVYQ GRFQDNGACG
610 620 630 640 650
YVLKPAFLRD PNGTFNPRAL AQGPWWARKR LNIRVISGQQ LPKVNKNKNS
660 670 680 690 700
IVDPKVTVEI HGVSRDVASR QTAVITNNGF NPWWDTEFAF EVVVPDLALI
710 720 730 740 750
RFLVEDYDAS SKNDFIGQST IPLNSLKQGY RHVHLMSKNG DQHPSATLFV

KISLQD
Length:756
Mass (Da):85,665
Last modified:September 23, 2008 - v2
Checksum:i6C6FD7F89BA08C83
GO
Isoform 2 (identifier: P51178-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MDSGRDFLTLH → MQCLGIRSRSRSRELYLQERSLKVAALNGRRL

Note: No experimental confirmation available.

Show »
Length:777
Mass (Da):88,135
Checksum:i6260C76BE397266B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti224 – 2241S → P in AAA73567. (PubMed:7890667)Curated
Sequence conflicti264 – 2641A → T in AAA73567. (PubMed:7890667)Curated
Sequence conflicti591 – 5911G → D in AAA73567. (PubMed:7890667)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti209 – 2091T → R in NDNC3. 1 Publication
VAR_066399
Natural varianti257 – 2571R → H.
Corresponds to variant rs933135 [ dbSNP | Ensembl ].
VAR_046560
Natural varianti574 – 5741I → T in NDNC3. 1 Publication
VAR_066400

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1111MDSGRDFLTLH → MQCLGIRSRSRSRELYLQER SLKVAALNGRRL in isoform 2. 1 PublicationVSP_042919Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U09117 mRNA. Translation: AAA73567.1.
AK090774 mRNA. Translation: BAG52226.1.
AC144536 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64507.1.
BC050382 mRNA. Translation: AAH50382.2.
CCDSiCCDS2671.1. [P51178-1]
CCDS46793.1. [P51178-2]
PIRiA55943.
RefSeqiNP_001124436.1. NM_001130964.1. [P51178-2]
NP_006216.2. NM_006225.3. [P51178-1]
UniGeneiHs.80776.

Genome annotation databases

EnsembliENST00000334661; ENSP00000335600; ENSG00000187091. [P51178-1]
ENST00000463876; ENSP00000430344; ENSG00000187091. [P51178-2]
GeneIDi5333.
KEGGihsa:5333.
UCSCiuc003chm.3. human. [P51178-2]
uc003chn.3. human. [P51178-1]

Polymorphism databases

DMDMi206729887.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U09117 mRNA. Translation: AAA73567.1 .
AK090774 mRNA. Translation: BAG52226.1 .
AC144536 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64507.1 .
BC050382 mRNA. Translation: AAH50382.2 .
CCDSi CCDS2671.1. [P51178-1 ]
CCDS46793.1. [P51178-2 ]
PIRi A55943.
RefSeqi NP_001124436.1. NM_001130964.1. [P51178-2 ]
NP_006216.2. NM_006225.3. [P51178-1 ]
UniGenei Hs.80776.

3D structure databases

ProteinModelPortali P51178.
SMRi P51178. Positions 12-130, 158-756.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111349. 11 interactions.
IntActi P51178. 1 interaction.
MINTi MINT-107564.
STRINGi 9606.ENSP00000409572.

Chemistry

BindingDBi P51178.
ChEMBLi CHEMBL3727.

PTM databases

PhosphoSitei P51178.

Polymorphism databases

DMDMi 206729887.

2D gel databases

REPRODUCTION-2DPAGE IPI00746030.

Proteomic databases

MaxQBi P51178.
PaxDbi P51178.
PRIDEi P51178.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000334661 ; ENSP00000335600 ; ENSG00000187091 . [P51178-1 ]
ENST00000463876 ; ENSP00000430344 ; ENSG00000187091 . [P51178-2 ]
GeneIDi 5333.
KEGGi hsa:5333.
UCSCi uc003chm.3. human. [P51178-2 ]
uc003chn.3. human. [P51178-1 ]

Organism-specific databases

CTDi 5333.
GeneCardsi GC03M038023.
H-InvDB HIX0003175.
HGNCi HGNC:9060. PLCD1.
HPAi CAB009913.
HPA020107.
HPA021677.
MIMi 151600. phenotype.
602142. gene.
neXtProti NX_P51178.
Orphaneti 2387. Leukonychia totalis.
PharmGKBi PA33388.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG149692.
GeneTreei ENSGT00760000118936.
HOGENOMi HOG000006871.
HOVERGENi HBG053610.
InParanoidi P51178.
KOi K05857.
OMAi TSGQAFY.
OrthoDBi EOG7V49XT.
PhylomeDBi P51178.
TreeFami TF313216.

Enzyme and pathway databases

BioCyci MetaCyc:HS07195-MONOMER.
Reactomei REACT_150312. Synthesis of IP3 and IP4 in the cytosol.

Miscellaneous databases

GeneWikii PLCD1.
GenomeRNAii 5333.
NextBioi 20654.
PROi P51178.
SOURCEi Search...

Gene expression databases

Bgeei P51178.
CleanExi HS_PLCD1.
Genevestigatori P51178.

Family and domain databases

Gene3Di 1.10.238.10. 2 hits.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProi IPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR028391. PLC-delta1.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view ]
PANTHERi PTHR10336. PTHR10336. 1 hit.
PTHR10336:SF80. PTHR10336:SF80. 1 hit.
Pfami PF00168. C2. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view ]
PRINTSi PR00390. PHPHLIPASEC.
SMARTi SM00239. C2. 1 hit.
SM00054. EFh. 2 hits.
SM00233. PH. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEi PS50004. C2. 1 hit.
PS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 2 hits.
PS50003. PH_DOMAIN. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and identification of amino acid residues of human phospholipase C delta 1 essential for catalysis."
    Cheng H.F., Jiang M.J., Chen C.L., Liu S.M., Wong L.P., Lomasney J.W., King K.
    J. Biol. Chem. 270:5495-5505(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Aorta.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Amygdala.
  3. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  6. "Hereditary leukonychia, or porcelain nails, resulting from mutations in PLCD1."
    Kiuru M., Kurban M., Itoh M., Petukhova L., Shimomura Y., Wajid M., Christiano A.M.
    Am. J. Hum. Genet. 88:839-844(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS NDNC3 ARG-209 AND THR-574.

Entry informationi

Entry nameiPLCD1_HUMAN
AccessioniPrimary (citable) accession number: P51178
Secondary accession number(s): B3KR14, Q86VN8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: September 23, 2008
Last modified: October 29, 2014
This is version 154 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3