P51178 (PLCD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 138.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 EC=3.1.4.11 Alternative name(s): Phosphoinositide phospholipase C-delta-1 Phospholipase C-III Short name=PLC-III Phospholipase C-delta-1 Short name=PLC-delta-1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 756 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. Essential for trophoblast and placental development. |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol. |
| Cofactor | Binds 3 calcium ions per subunit. Two of the calcium ions are bound to the C2 domain By similarity. |
| Involvement in disease | Nail disorder, non-syndromic congenital, 3 (NDNC3) [MIM:151600]: A nail disorder characterized by a white appearance of the nail plate (true leukonychia), the nail bed (pseudoleukonychia), or neither (apparent leukonychia). Leukonychia may involve all of the nail (leukonychia totalis) or only part of the nail (leukonychia partialis), or can appear as one or more transverse bands (leukonychia striata) or white spots (leukonychia punctata). |
| Sequence similarities | Contains 1 C2 domain. Contains 2 EF-hand domains. Contains 1 PH domain. Contains 1 PI-PLC X-box domain. Contains 1 PI-PLC Y-box domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P51178-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P51178-2) The sequence of this isoform differs from the canonical sequence as follows: 1-11: MDSGRDFLTLH → MQCLGIRSRSRSRELYLQERSLKVAALNGRRL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 756 | 756 | 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 | PRO_0000088504 | |||||
Regions | |||||||||
| Domain | 21 – 130 | 110 | PH | ||||||
| Domain | 140 – 175 | 36 | EF-hand 1 | ||||||
| Domain | 176 – 211 | 36 | EF-hand 2 | ||||||
| Domain | 296 – 440 | 145 | PI-PLC X-box | ||||||
| Domain | 492 – 609 | 118 | PI-PLC Y-box | ||||||
| Domain | 616 – 720 | 105 | C2 | ||||||
| Calcium binding | 153 – 164 | 12 | 1 Potential | ||||||
| Calcium binding | 189 – 200 | 12 | 2 Potential | ||||||
| Region | 30 – 57 | 28 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Active site | 311 | 1 | By similarity | ||||||
| Active site | 356 | 1 | By similarity | ||||||
| Metal binding | 312 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 341 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 343 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 390 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 651 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 653 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 677 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 706 | 1 | Calcium 3 By similarity | ||||||
| Metal binding | 707 | 1 | Calcium 3; via carbonyl oxygen By similarity | ||||||
| Metal binding | 708 | 1 | Calcium 3 By similarity | ||||||
| Binding site | 438 | 1 | Substrate By similarity | ||||||
| Binding site | 440 | 1 | Substrate By similarity | ||||||
| Binding site | 522 | 1 | Substrate By similarity | ||||||
| Binding site | 549 | 1 | Substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 11 | 11 | MDSGRDFLTLH → MQCLGIRSRSRSRELYLQER SLKVAALNGRRL in isoform 2. | VSP_042919 | |||||
| Natural variant | 209 | 1 | T → R in NDNC3. Ref.6 | VAR_066399 | |||||
| Natural variant | 257 | 1 | R → H. Corresponds to variant rs933135 [ dbSNP | Ensembl ]. | VAR_046560 | |||||
| Natural variant | 574 | 1 | I → T in NDNC3. Ref.6 | VAR_066400 | |||||
Experimental info | |||||||||
| Sequence conflict | 224 | 1 | S → P in AAA73567. Ref.1 | ||||||
| Sequence conflict | 264 | 1 | A → T in AAA73567. Ref.1 | ||||||
| Sequence conflict | 591 | 1 | G → D in AAA73567. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U09117 mRNA. Translation: AAA73567.1. AK090774 mRNA. Translation: BAG52226.1. AC144536 Genomic DNA. No translation available. CH471055 Genomic DNA. Translation: EAW64507.1. BC050382 mRNA. Translation: AAH50382.2. |
| IPI | IPI00016461. IPI00746030. |
| PIR | A55943. |
| RefSeq | NP_001124436.1. NM_001130964.1. NP_006216.2. NM_006225.3. |
| UniGene | Hs.80776. |
3D structure databases | |
| ProteinModelPortal | P51178. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-107564. |
| STRING | 9606.ENSP00000409572. |
PTM databases | |
| PhosphoSite | P51178. |
Polymorphism databases | |
| DMDM | 206729887. |
2D gel databases | |
| REPRODUCTION-2DPAGE | IPI00746030. |
Proteomic databases | |
| PaxDb | P51178. |
| PRIDE | P51178. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000334661; ENSP00000335600; ENSG00000187091. ENST00000463876; ENSP00000430344; ENSG00000187091. |
| GeneID | 5333. |
| KEGG | hsa:5333. |
| UCSC | uc003chn.3. human. |
Organism-specific databases | |
| CTD | 5333. |
| GeneCards | GC03M038023. |
| H-InvDB | HIX0003175. |
| HGNC | HGNC:9060. PLCD1. |
| HPA | CAB009913. HPA020107. HPA021677. |
| MIM | 151600. phenotype. 602142. gene. |
| neXtProt | NX_P51178. |
| Orphanet | 2387. Leukonychia totalis. |
| PharmGKB | PA33388. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG149692. |
| HOGENOM | HOG000006871. |
| HOVERGEN | HBG053610. |
| KO | K05857. |
| OMA | MGHRTEG. |
| OrthoDB | EOG4H19V6. |
| PhylomeDB | P51178. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS07195-MONOMER. |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| Bgee | P51178. |
| CleanEx | HS_PLCD1. |
| Genevestigator | P51178. |
| GermOnline | ENSG00000187091. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.238.10. 2 hits. 2.30.29.30. 1 hit. 3.20.20.190. 2 hits. |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR002048. EF_hand_dom. IPR011993. PH_like_dom. IPR001192. Pinositol_PLipase_C. IPR017946. PLC-like_Pdiesterase_TIM-brl. IPR001849. Pleckstrin_homology. IPR015359. PLipase_C_EF-hand-like. IPR000909. PLipase_C_PInositol-sp_X_dom. IPR001711. PLipase_C_Pinositol-sp_Y. [Graphical view] |
| PANTHER | PTHR10336. PTHR10336. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF09279. efhand_like. 1 hit. PF00388. PI-PLC-X. 1 hit. PF00387. PI-PLC-Y. 1 hit. [Graphical view] |
| PRINTS | PR00390. PHPHLIPASEC. |
| SMART | SM00239. C2. 1 hit. SM00054. EFh. 2 hits. SM00233. PH. 1 hit. SM00148. PLCXc. 1 hit. SM00149. PLCYc. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF51695. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| PROSITE | PS50004. C2. 1 hit. PS00018. EF_HAND_1. 2 hits. PS50222. EF_HAND_2. 2 hits. PS50003. PH_DOMAIN. 1 hit. PS50007. PIPLC_X_DOMAIN. 1 hit. PS50008. PIPLC_Y_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P51178. |
| ChEMBL | CHEMBL3727. |
| GenomeRNAi | 5333. |
| NextBio | 20654. |
| SOURCE | Search... |
Entry information
| Entry name | PLCD1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P51178 Secondary accession number(s): B3KR14, Q86VN8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
