P51168 (SCNNB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 135.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Amiloride-sensitive sodium channel subunit beta Alternative name(s): Beta-NaCH Epithelial Na(+) channel subunit beta Short name=Beta-ENaC Short name=ENaCB Nonvoltage-gated sodium channel 1 subunit beta SCNEB | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 640 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception. |
| Enzyme regulation | Activated by WNK1, WNK2, WNK3 and WNK4 By similarity. |
| Subunit structure | Probable heterotrimer containing one alpha, one beta and one gamma subunit. A delta subunit can replace the alpha subunit. Interacts with the WW domains of NEDD4, NEDD4L, WWP1 and WWP2. Interacts with the full length immature form of PCSK9 (pro-PCSK9). Ref.11 Ref.12 Ref.13 Ref.16 |
| Subcellular location | Apical cell membrane; Multi-pass membrane protein. Note: Apical membrane of epithelial cells. |
| Post-translational modification | Phosphorylated on serine and threonine residues By similarity. |
| Involvement in disease | Pseudohypoaldosteronism 1, autosomal recessive (PHA1B) [MIM:264350]: A rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. PHA1B is a severe form involving multiple organ systems, and characterized by an often fulminant presentation in the neonatal period with dehydration, hyponatremia, hyperkalemia, metabolic acidosis, failure to thrive and weight loss. Liddle syndrome (LIDDS) [MIM:177200]: Autosomal dominant disorder characterized by pseudoaldosteronism and hypertension associated with hypokalemic alkalosis. The disease is caused by constitutive activation of the renal epithelial sodium channel. Bronchiectasis with or without elevated sweat chloride 1 (BESC1) [MIM:211400]: A debilitating respiratory disease characterized by chronic, abnormal dilatation of the bronchi and other cystic fibrosis-like symptoms in the absence of known causes of bronchiectasis (cystic fibrosis, autoimmune diseases, ciliary dyskinesia, common variable immunodeficiency, foreign body obstruction). Clinical features include sub-normal lung function, sinopulmonary infections, chronic productive cough, excessive sputum production, and elevated sweat chloride in some cases. |
| Sequence similarities | Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P51168-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P51168-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLLHINPAYLFKLLHGFPPWIMPTDGNLGDKNFQMGKPGHREGATM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 640 | 640 | Amiloride-sensitive sodium channel subunit beta | PRO_0000181268 | |||||
Regions | |||||||||
| Topological domain | 1 – 51 | 51 | Cytoplasmic By similarity | ||||||
| Transmembrane | 52 – 75 | 24 | Helical; By similarity | ||||||
| Topological domain | 76 – 514 | 439 | Extracellular By similarity | ||||||
| Transmembrane | 515 – 545 | 31 | Helical; By similarity | ||||||
| Topological domain | 546 – 640 | 95 | Cytoplasmic By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 135 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 141 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 199 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 207 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 260 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 364 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 378 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 449 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 484 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MLLHINPAYLFKLLHGFPPW IMPTDGNLGDKNFQMGKPGH REGATM in isoform 2. | VSP_007724 | |||||
| Natural variant | 37 | 1 | G → S in PHA1B. Ref.20 | VAR_007127 | |||||
| Natural variant | 82 | 1 | S → C in BESC1. Ref.27 Ref.30 | VAR_062401 | |||||
| Natural variant | 267 | 1 | P → L in BESC1; decreased channel activity. Ref.27 | VAR_062402 | |||||
| Natural variant | 288 | 1 | N → S in BESC1. Ref.30 | VAR_062403 | |||||
| Natural variant | 294 | 1 | G → S in BESC1; increased channel activity. Ref.27 | VAR_062404 | |||||
| Natural variant | 311 | 1 | A → V in a colorectal cancer sample; somatic mutation. Ref.29 | VAR_036480 | |||||
| Natural variant | 314 | 1 | A → V in a breast cancer sample; somatic mutation. Ref.29 | VAR_036481 | |||||
| Natural variant | 336 | 1 | A → P. Ref.2 Ref.24 | VAR_015836 | |||||
| Natural variant | 348 | 1 | V → M in BESC1. Ref.31 | VAR_062405 | |||||
| Natural variant | 369 | 1 | P → T in BESC1. Ref.30 | VAR_062406 | |||||
| Natural variant | 387 | 1 | L → V in a breast cancer sample; somatic mutation. Ref.29 | VAR_036482 | |||||
| Natural variant | 434 | 1 | V → M. Ref.21 | VAR_015837 | |||||
| Natural variant | 442 | 1 | G → V. Ref.21 Ref.31 Corresponds to variant rs1799980 [ dbSNP | Ensembl ]. | VAR_014891 | |||||
| Natural variant | 539 | 1 | E → K in BESC1; decreased channel activity. Ref.27 | VAR_062407 | |||||
| Natural variant | 563 | 1 | R → Q Associated with hypertension in South African Black. Ref.25 | VAR_026519 | |||||
| Natural variant | 589 | 1 | G → S. Ref.21 | VAR_015838 | |||||
| Natural variant | 594 | 1 | T → M. Ref.21 Corresponds to variant rs1799979 [ dbSNP | Ensembl ]. | VAR_014892 | |||||
| Natural variant | 597 | 1 | R → H. Ref.21 | VAR_015839 | |||||
| Natural variant | 616 | 1 | P → L in LIDDS. Ref.17 Ref.18 Ref.23 | VAR_007128 | |||||
| Natural variant | 616 | 1 | P → S in LIDDS. Ref.23 | VAR_007129 | |||||
| Natural variant | 617 | 1 | P → S in LIDDS. Ref.22 | VAR_026520 | |||||
| Natural variant | 618 | 1 | P → R in LIDDS. Ref.28 | VAR_026521 | |||||
| Natural variant | 620 | 1 | Y → H in LIDDS; constitutive channel activation. Ref.19 | VAR_026522 | |||||
| Natural variant | 624 | 1 | R → C. Ref.21 | VAR_015840 | |||||
| Natural variant | 632 | 1 | E → G. Ref.21 | VAR_015841 | |||||
Experimental info | |||||||||
| Sequence conflict | 41 | 1 | I → T in AAH36352. Ref.6 | ||||||
| Sequence conflict | 314 | 1 | A → G in CAA60632. Ref.1 | ||||||
| Sequence conflict | 498 | 1 | Y → F in AAA75459. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, chromosomal localization, and physical linkage of the beta and gamma subunits (SCNN1B and SCNN1G) of the human epithelial amiloride-sensitive sodium channel." Voilley N., Bassilana F., Mignon C., Merscher S., Mattei M.-G., Carle G.F., Lazdunski M., Barbry P. Genomics 28:560-565(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Lung. |
| [2] | "Cloning and expression of the beta- and gamma-subunits of the human epithelial sodium channel." McDonald F.J., Snyder P.M., Price M.P., Welsh M.J. Am. J. Physiol. 268:C1157-C1163(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT PRO-336. Tissue: Kidney. |
| [3] | "Gene structure of the human amiloride-sensitive epithelial sodium channel beta subunit." Saxena A., Hanukoglu I., Strautnieks S.S., Thompson R.J., Gardiner R.M., Hanukoglu A. Biochem. Biophys. Res. Commun. 252:208-213(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Epithelium. |
| [4] | "Novel mutations responsible for autosomal recessive multisystem pseudohypoaldosteronism and sequence variants in epithelial sodium channel alpha-, beta-, and gamma-subunit genes." Saxena A., Hanukoglu I., Saxena D., Thompson R.J., Gardiner R.M., Hanukoglu A. J. Clin. Endocrinol. Metab. 87:3344-3350(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain, Lung and Testis. |
| [7] | "Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q." Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Cronin L., Mays A.D., Cao Y., Xu R.X., Kang H.-L., Mitchell S., Eichler E.E., Harris P.C., Venter J.C., Adams M.D. Genomics 60:295-308(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] OF 1-259. |
| [8] | "Separate promoters of the human epithelial sodium channel beta subunit direct expression of alternate transcripts that encode N-terminal protein variants." Thomas C.P., Auerbach S.D., Loftus R.W., Li X., Itani O.A. Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-56 (ISOFORM 2). Tissue: Kidney. |
| [9] | "Liddle's syndrome: heritable human hypertension caused by mutations in the beta subunit of the epithelial sodium channel." Shimkets R.A., Warnock D.G., Bositis C.M., Nelson-Williams C., Hansson J.H., Schambelan M., Gill J.R., Ulick S., Milora R.V., Findling J.W., Canessa C.M., Rossier B.C., Lifton R.P. Cell 79:407-414(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 515-640. |
| [10] | "Type I pseudohypoaldosteronism includes two clinically and genetically distinct entities with either renal or multiple target organ defects." Hanukoglu A. J. Clin. Endocrinol. Metab. 73:936-944(1991) [PubMed] [Europe PMC] [Abstract] Cited for: DEFINITION OF DIFFERENT FORMS OF PSEUDOHYPOALDOSTERONISM TYPE 1. |
| [11] | "Identification of novel human WW domain-containing proteins by cloning of ligand targets." Pirozzi G., McConnell S.J., Uveges A.J., Carter J.M., Sparks A.B., Kay B.K., Fowlkes D.M. J. Biol. Chem. 272:14611-14616(1997) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH WWP1 AND WWP2. |
| [12] | "The Nedd4-like protein KIAA0439 is a potential regulator of the epithelial sodium channel." Harvey K.F., Dinudom A., Cook D.I., Kumar S. J. Biol. Chem. 276:8597-8601(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NEDD4 AND NEDD4L. |
| [13] | "Ubiquitin-protein ligase WWP2 binds to and downregulates the epithelial Na(+) channel." McDonald F.J., Western A.H., McNeil J.D., Thomas B.C., Olson D.R., Snyder P.M. Am. J. Physiol. 283:F431-F436(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NEDD4 AND WWP2. |
| [14] | "Renin-aldosterone response, urinary Na/K ratio and growth in pseudohypoaldosteronism patients with mutations in epithelial sodium channel (ENaC) subunit genes." Hanukoglu A., Edelheit O., Shriki Y., Gizewska M., Dascal N., Hanukoglu I. J. Steroid Biochem. Mol. Biol. 111:268-274(2008) [PubMed] [Europe PMC] [Abstract] Cited for: GENOTYPE-PHENOTYPE RELATIONSHIPS IN PHA1B, LONG-TERM EFFECTS OF MUTATIONS ON PHA1B. |
| [15] | "Truncated beta epithelial sodium channel (ENaC) subunits responsible for multi-system pseudohypoaldosteronism support partial activity of ENaC." Edelheit O., Hanukoglu I., Shriki Y., Tfilin M., Dascal N., Gillis D., Hanukoglu A. J. Steroid Biochem. Mol. Biol. 119:84-88(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN PSEUDOHYPOALDOSTERONISM TYPE 1. |
| [16] | "Regulation of epithelial sodium channel trafficking by proprotein convertase subtilisin/kexin type 9 (PCSK9)." Sharotri V., Collier D.M., Olson D.R., Zhou R., Snyder P.M. J. Biol. Chem. 287:19266-19274(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PCSK9. |
| [17] | "Hypertension caused by a truncated epithelial sodium channel gamma subunit: genetic heterogeneity of Liddle syndrome." Hansson J.H., Nelson-Williams C., Suzuki H., Schild L., Shimkets R.A., Lu Y., Canessa C.M., Iwasaki T., Rossier B.C., Lifton R.P. Nat. Genet. 11:76-82(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LIDDS LEU-616. |
| [18] | "A de novo missense mutation of the beta subunit of the epithelial sodium channel causes hypertension and Liddle syndrome, identifying a proline-rich segment critical for regulation of channel activity." Hansson J.H., Schild L., Lu Y., Wilson T.A., Gautschi I., Shimkets R.A., Nelson-Williams C., Rossier B.C., Lifton R.P. Proc. Natl. Acad. Sci. U.S.A. 92:11495-11499(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LIDDS LEU-616. |
| [19] | "Liddle disease caused by a missense mutation of beta subunit of the epithelial sodium channel gene." Tamura H., Schild L., Enomoto N., Matsui N., Marumo F., Rossier B.C. J. Clin. Invest. 97:1780-1784(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LIDDS HIS-620, CHARACTERIZATION OF VARIANT LIDDS HIS-620. |
| [20] | "Mutations in subunits of the epithelial sodium channel cause salt wasting with hyperkalaemic acidosis, pseudohypoaldosteronism type 1." Chang S.S., Grunder S., Hanukoglu A., Roesler A., Mathew P.M., Hanukoglu I., Schild L., Lu Y., Shimkets R.A., Nelson-Williams C., Rossier B.C., Lifton R.P. Nat. Genet. 12:248-253(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PHA1B SER-37. |
| [21] | "Genetic analysis of the beta subunit of the epithelial Na+ channel in essential hypertension." Persu A., Barbry P., Bassilana F., Houot A.-M., Mengual R., Lazdunski M., Corvol P., Jeunemaitre X. Hypertension 32:129-137(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS MET-434; VAL-442; SER-589; MET-594; HIS-597; CYS-624 AND GLY-632. |
| [22] | "A family with Liddle's syndrome caused by a new missense mutation in the beta subunit of the epithelial sodium channel." Inoue J., Iwaoka T., Tokunaga H., Takamune K., Naomi S., Araki M., Takahama K., Yamaguchi K., Tomita K. J. Clin. Endocrinol. Metab. 83:2210-2213(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LIDDS SER-617. |
| [23] | "Genetic analysis of the epithelial sodium channel in Liddle's syndrome." Uehara Y., Sasaguri M., Kinoshita A., Tsuji E., Kiyose H., Taniguchi H., Noda K., Ideishi M., Inoue J., Tomita K., Arakawa K. J. Hypertens. 16:1131-1135(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS LIDDS LEU-616 AND SER-616. |
| [24] | "Polymorphisms of amiloride-sensitive sodium channel subunits in five sporadic cases of pseudohypoaldosteronism: do they have pathologic potential?" Arai K., Zachman K., Shibasaki T., Chrousos G.P. J. Clin. Endocrinol. Metab. 84:2434-2437(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PRO-336. |
| [25] | "A new mutation, R563Q, of the beta subunit of the epithelial sodium channel associated with low-renin, low-aldosterone hypertension." Rayner B.L., Owen E.P., King J.A., Soule S.G., Vreede H., Opie L.H., Marais D., Davidson J.S. J. Hypertens. 21:921-926(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GLN-563, ASSOCIATION WITH HYPERTENSION. |
| [26] | "Novel mutations in epithelial sodium channel (ENaC) subunit genes and phenotypic expression of multisystem pseudohypoaldosteronism." Edelheit O., Hanukoglu I., Gizewska M., Kandemir N., Tenenbaum-Rakover Y., Yurdakoek M., Zajaczek S., Hanukoglu A. Clin. Endocrinol. (Oxf.) 62:547-553(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN PSEUDOHYPOALDOSTERONISM TYPE 1. |
| [27] | "Mutations in the beta-subunit of the epithelial Na+ channel in patients with a cystic fibrosis-like syndrome." Sheridan M.B., Fong P., Groman J.D., Conrad C., Flume P., Diaz R., Harris C., Knowles M., Cutting G.R. Hum. Mol. Genet. 14:3493-3498(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS BESC1 CYS-82; LEU-267; SER-294 AND LYS-539, CHARACTERIZATION OF VARIANTS BESC1 LEU-267; SER-294 AND LYS-539. |
| [28] | "Liddle's syndrome caused by a novel mutation in the proline-rich PY motif of the epithelial sodium channel beta-subunit." Furuhashi M., Kitamura K., Adachi M., Miyoshi T., Wakida N., Ura N., Shikano Y., Shinshi Y., Sakamoto K., Hayashi M., Satoh N., Nishitani T., Tomita K., Shimamoto K. J. Clin. Endocrinol. Metab. 90:340-344(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LIDDS ARG-618. |
| [29] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] VAL-311; VAL-314 AND VAL-387. |
| [30] | "Could a defective epithelial sodium channel lead to bronchiectasis." Fajac I., Viel M., Sublemontier S., Hubert D., Bienvenu T. Respir. Res. 9:46-46(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS BESC1 CYS-82; SER-288 AND THR-369. |
| [31] | "Genetic analysis of Rwandan patients with cystic fibrosis-like symptoms: identification of novel cystic fibrosis transmembrane conductance regulator and epithelial sodium channel gene variants." Mutesa L., Azad A.K., Verhaeghe C., Segers K., Vanbellinghen J.F., Ngendahayo L., Rusingiza E.K., Mutwa P.R., Rulisa S., Koulischer L., Cassiman J.J., Cuppens H., Bours V. Chest 135:1233-1242(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT BESC1 MET-348, VARIANT VAL-442. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X87159 mRNA. Translation: CAA60632.1. L36593 mRNA. Translation: AAA75459.1. AJ005383 AJ005393 Genomic DNA. Translation: CAA06508.2.FJ515831 Genomic DNA. Translation: ACS13723.1. BC036352 mRNA. Translation: AAH36352.2. AC130452 Genomic DNA. No translation available. AF260226 mRNA. Translation: AAK49394.1. U16023 Genomic DNA. Translation: AAA67036.1. |
| IPI | IPI00178024. IPI00332882. |
| PIR | I51915. |
| RefSeq | NP_000327.2. NM_000336.2. |
| UniGene | Hs.414614. |
3D structure databases | |
| ProteinModelPortal | P51168. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P51168. 1 interaction. |
| MINT | MINT-198733. |
| STRING | 9606.ENSP00000345751. |
Protein family/group databases | |
| TCDB | 1.A.6.1.1. epithelial Na+ channel (ENaC) family. |
PTM databases | |
| PhosphoSite | P51168. |
Polymorphism databases | |
| DMDM | 8928561. |
Proteomic databases | |
| PaxDb | P51168. |
| PRIDE | P51168. |
Protocols and materials databases | |
| DNASU | 6338. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000307331; ENSP00000302874; ENSG00000168447. ENST00000343070; ENSP00000345751; ENSG00000168447. |
| GeneID | 6338. |
| KEGG | hsa:6338. |
| UCSC | uc002dln.3. human. |
Organism-specific databases | |
| CTD | 6338. |
| GeneCards | GC16P023221. |
| H-InvDB | HIX0026943. |
| HGNC | HGNC:10600. SCNN1B. |
| HPA | HPA015612. |
| MIM | 177200. phenotype. 211400. phenotype. 264350. phenotype. 600760. gene. |
| neXtProt | NX_P51168. |
| Orphanet | 171876. Generalized pseudohypoaldosteronism type 1. 526. Liddle syndrome. |
| PharmGKB | PA306. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG294559. |
| HOGENOM | HOG000236286. |
| HOVERGEN | HBG058435. |
| InParanoid | P51168. |
| KO | K04825. |
| OMA | PDWAYCY. |
| OrthoDB | EOG4SJ5D8. |
Gene expression databases | |
| ArrayExpress | P51168. |
| Bgee | P51168. |
| CleanEx | HS_SCNN1B. |
| Genevestigator | P51168. |
| GermOnline | ENSG00000168447. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004724. EnaC. IPR001873. Na+channel_ASC. IPR020903. Na+channel_ASC_CS. [Graphical view] |
| PANTHER | PTHR11690. PTHR11690. 1 hit. |
| Pfam | PF00858. ASC. 1 hit. [Graphical view] |
| PRINTS | PR01078. AMINACHANNEL. |
| TIGRFAMs | TIGR00859. ENaC. 1 hit. |
| PROSITE | PS01206. ASC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL1628483. |
| DrugBank | DB00594. Amiloride. DB00384. Triamterene. |
| GenomeRNAi | 6338. |
| NextBio | 24612. |
| SOURCE | Search... |
Entry information
| Entry name | SCNNB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P51168 Secondary accession number(s): C5HTZ2 Q9UMU5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
