P51161 (FABP6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Gastrotropin Short name=GT Alternative name(s): Fatty acid-binding protein 6 Ileal lipid-binding protein Short name=ILBP Intestinal 15 kDa protein Short name=I-15P Intestinal bile acid-binding protein Short name=I-BABP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 128 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Ileal protein which stimulates gastric acid and pepsinogen secretion. Seems to be able to bind to bile salts and bilirubins. Isoform 2 is essential for the survival of colon cancer cells to bile acid-induced apoptosis. Ref.3 |
| Subcellular location | Isoform 2: Cytoplasm. Note: Localized close to nucleus on the apical side of both normal and neoplastic cells. |
| Tissue specificity | Isoform 2 is expressed in colorectal adenocarcinomas and their adjacent normal mucosa (at protein level). Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is expressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. Ref.3 |
| Induction | Isoform 1 is up-regulated by chenodeoxycholic acid (CDCA) via the FXR transcription pathway. Isoform 2 is up-regulated by NF-kappa-B and in all stages of colorectal adenocarcinoma. Isoform 1 is not up-regulated in all stages of colorectal adenocarcinoma. Ref.3 |
| Domain | Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior. |
| Sequence similarities | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
| Sequence caution | The sequence AAH22489.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative promoter usage Polymorphism |
| Ligand | Lipid-binding |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | bile acid and bile salt transport Traceable author statement. Source: Reactome bile acid metabolic processTraceable author statement. Source: Reactome negative regulation of cell proliferationTraceable author statement. Source: ProtInc |
| Cellular component | cytosol Traceable author statement. Source: Reactome |
| Molecular function | lipid binding Traceable author statement. Source: ProtInc transporter activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative promoter usage. [Align] [Select] | ||||||
| Isoform 1 (identifier: P51161-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P51161-2) Also known as: IBABP-L; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKTVTMMMVVEMQALTQVLRAVLSACTWVSRKGDLQRMKQTHKGKPPSSM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||||||||||||||||||||||||||||
| Chain | 2 – 128 | 127 | Gastrotropin | PRO_0000067380 | |||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine By similarity | ||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MKTVTMMMVVEMQALTQVLR AVLSACTWVSRKGDLQRMKQ THKGKPPSSM in isoform 2. | VSP_038039 | |||||||||||||||||||||||||||||||
| Natural variant | 33 | 1 | R → H. Ref.5 Corresponds to variant rs17856662 [ dbSNP | Ensembl ]. | VAR_039578 | |||||||||||||||||||||||||||||||
| Natural variant | 55 | 1 | S → Y. Ref.5 Corresponds to variant rs17852045 [ dbSNP | Ensembl ]. | VAR_039579 | |||||||||||||||||||||||||||||||
| Natural variant | 79 | 1 | T → M. Corresponds to variant rs1130435 [ dbSNP | Ensembl ]. | VAR_039580 | |||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||
| Beta strand | 4 – 14 | 11 | |||||||||||||||||||||||||||||||||
| Helix | 15 – 22 | 8 | |||||||||||||||||||||||||||||||||
| Helix | 26 – 33 | 8 | |||||||||||||||||||||||||||||||||
| Beta strand | 38 – 42 | 5 | |||||||||||||||||||||||||||||||||
| Beta strand | 47 – 54 | 8 | |||||||||||||||||||||||||||||||||
| Beta strand | 57 – 65 | 9 | |||||||||||||||||||||||||||||||||
| Turn | 66 – 68 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 70 – 72 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 75 – 78 | 4 | |||||||||||||||||||||||||||||||||
| Beta strand | 80 – 82 | 3 | |||||||||||||||||||||||||||||||||
| Beta strand | 88 – 94 | 7 | |||||||||||||||||||||||||||||||||
| Beta strand | 99 – 104 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 106 – 117 | 12 | |||||||||||||||||||||||||||||||||
| Beta strand | 119 – 126 | 8 | |||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and chromosomal localization of the human ileal lipid-binding protein." Oelkers P., Dawson P.A. Biochim. Biophys. Acta 1257:199-202(1995) [PubMed: 7619861] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Ileum. |
| [2] | "Molecular cloning, expression, and characterization of a human intestinal 15-kDa protein." Fujita M., Fujii H., Kanda T., Sato E., Hatakeyama K., Ono T. Eur. J. Biochem. 233:406-413(1995) [PubMed: 7588781] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Ileum. |
| [3] | "A novel variant of ileal bile acid binding protein is up-regulated through nuclear factor-kappaB activation in colorectal adenocarcinoma." Fang C., Dean J., Smith J.W. Cancer Res. 67:9039-9046(2007) [PubMed: 17909007] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, ALTERNATIVE PROMOTER USAGE, INDUCTION, TISSUE SPECIFICITY. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed: 15372022] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS HIS-33 AND TYR-55. Tissue: Brain. |
| [6] | "The human ileal bile acid binding protein gene: promoter sequence and effects of CDX2 on expression." Barley N.F., Shaw-Smith C.J., Chakravarty P., Howard A., Legon S., Walters J.R. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-19 (ISOFORM 1). |
| [7] | "Insights into the bile acid transportation system: the human ileal lipid-binding protein-cholyltaurine complex and its comparison with homologous structures." Kurz M., Brachvogel V., Matter H., Stengelin S., Thuering H., Kramer W. Proteins 50:312-328(2003) [PubMed: 12486725] [Abstract] Cited for: STRUCTURE BY NMR IN COMPLEX WITH BILE ACID. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U19869 mRNA. Translation: AAB82751.1. X90908 mRNA. Translation: CAA62415.1. DQ132786 mRNA. Translation: ABA12611.1. AC008609 Genomic DNA. No translation available. AC112191 Genomic DNA. No translation available. BC022489 mRNA. Translation: AAH22489.1. Different initiation. AJ250902 Genomic DNA. Translation: CAB65728.1. | ||||||||||||||||||
| IPI | IPI00163119. IPI00744927. | ||||||||||||||||||
| PIR | S63983. | ||||||||||||||||||
| RefSeq | NP_001035532.1. NM_001040442.1. NP_001124430.1. NM_001130958.1. NP_001436.1. NM_001445.2. | ||||||||||||||||||
| UniGene | Hs.519719. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P51161. | ||||||||||||||||||
| SMR | P51161. Positions 2-128. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| STRING | P51161. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 1708457. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P51161. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000310650; ENSP00000312283; ENSG00000170231. ENST00000393980; ENSP00000377549; ENSG00000170231. ENST00000393982; ENSP00000377551; ENSG00000170231. ENST00000402432; ENSP00000385433; ENSG00000170231. | ||||||||||||||||||
| GeneID | 2172. | ||||||||||||||||||
| KEGG | hsa:2172. | ||||||||||||||||||
| UCSC | uc003lxx.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 2172. | ||||||||||||||||||
| GeneCards | GC05P159573. | ||||||||||||||||||
| HGNC | HGNC:3561. FABP6. | ||||||||||||||||||
| HPA | CAB024713. HPA012601. | ||||||||||||||||||
| MIM | 600422. gene. | ||||||||||||||||||
| neXtProt | NX_P51161. | ||||||||||||||||||
| PharmGKB | PA27962. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOVERGEN | HBG005633. | ||||||||||||||||||
| InParanoid | P51161. | ||||||||||||||||||
| OMA | TVKMEGG. | ||||||||||||||||||
| OrthoDB | EOG4S1T8K. | ||||||||||||||||||
| PhylomeDB | P51161. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_22258. Metabolism of lipids and lipoproteins. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P51161. | ||||||||||||||||||
| Bgee | P51161. | ||||||||||||||||||
| CleanEx | HS_FABP6. | ||||||||||||||||||
| Genevestigator | P51161. | ||||||||||||||||||
| GermOnline | ENSG00000170231. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR012674. Calycin. IPR011038. Calycin-like. IPR000463. Fatty_acid-bd. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:2.40.128.20. Calycin. 1 hit. | ||||||||||||||||||
| KO | K08755. | ||||||||||||||||||
| PRINTS | PR00178. FATTYACIDBP. | ||||||||||||||||||
| SUPFAM | SSF50814. Calycin. 1 hit. | ||||||||||||||||||
| PROSITE | PS00214. FABP. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 8771. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | FABP6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P51161 Secondary accession number(s): Q07DR7, Q8TBI3, Q9UGI7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with