Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P51161

- FABP6_HUMAN

UniProt

P51161 - FABP6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Gastrotropin

Gene

FABP6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Ileal protein which stimulates gastric acid and pepsinogen secretion. Seems to be able to bind to bile salts and bilirubins. Isoform 2 is essential for the survival of colon cancer cells to bile acid-induced apoptosis.1 Publication

GO - Molecular functioni

  1. lipid binding Source: ProtInc
  2. transporter activity Source: InterPro

GO - Biological processi

  1. bile acid and bile salt transport Source: Reactome
  2. bile acid metabolic process Source: Reactome
  3. lipid metabolic process Source: ProtInc
  4. negative regulation of cell proliferation Source: ProtInc
  5. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

Lipid-binding

Enzyme and pathway databases

ReactomeiREACT_11042. Recycling of bile acids and salts.
REACT_267716. Orphan transporters.

Names & Taxonomyi

Protein namesi
Recommended name:
Gastrotropin
Short name:
GT
Alternative name(s):
Fatty acid-binding protein 6
Ileal lipid-binding protein
Short name:
ILBP
Intestinal 15 kDa protein
Short name:
I-15P
Intestinal bile acid-binding protein
Short name:
I-BABP
Gene namesi
Name:FABP6
Synonyms:ILBP, ILLBP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:3561. FABP6.

Subcellular locationi

Isoform 2 : Cytoplasm
Note: Localized close to nucleus on the apical side of both normal and neoplastic cells.

GO - Cellular componenti

  1. cytoplasm Source: ProtInc
  2. cytosol Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27962.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 128127GastrotropinPRO_0000067380Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineBy similarity

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiP51161.
PaxDbiP51161.
PRIDEiP51161.

PTM databases

PhosphoSiteiP51161.

Expressioni

Tissue specificityi

Isoform 2 is expressed in colorectal adenocarcinomas and their adjacent normal mucosa (at protein level). Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is expressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum.1 Publication

Inductioni

Isoform 1 is up-regulated by chenodeoxycholic acid (CDCA) via the FXR transcription pathway. Isoform 2 is up-regulated by NF-kappa-B and in all stages of colorectal adenocarcinoma. Isoform 1 is not up-regulated in all stages of colorectal adenocarcinoma.1 Publication

Gene expression databases

BgeeiP51161.
CleanExiHS_FABP6.
ExpressionAtlasiP51161. baseline and differential.
GenevestigatoriP51161.

Organism-specific databases

HPAiCAB024713.
HPA012601.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000377549.

Structurei

Secondary structure

1
128
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi4 – 1411Combined sources
Helixi15 – 228Combined sources
Helixi26 – 338Combined sources
Beta strandi38 – 425Combined sources
Beta strandi47 – 548Combined sources
Beta strandi57 – 659Combined sources
Turni66 – 683Combined sources
Beta strandi70 – 723Combined sources
Beta strandi75 – 784Combined sources
Beta strandi80 – 823Combined sources
Beta strandi88 – 947Combined sources
Beta strandi99 – 1046Combined sources
Beta strandi106 – 11712Combined sources
Beta strandi119 – 1268Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1O1UNMR-A2-128[»]
1O1VNMR-A2-128[»]
2MM3NMR-A2-128[»]
ProteinModelPortaliP51161.
SMRiP51161. Positions 2-128.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP51161.

Family & Domainsi

Domaini

Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG275686.
GeneTreeiENSGT00390000012034.
HOGENOMiHOG000004830.
HOVERGENiHBG005633.
InParanoidiP51161.
KOiK08755.
OMAiFKATVKM.
OrthoDBiEOG7HB5C9.
PhylomeDBiP51161.
TreeFamiTF330348.

Family and domain databases

Gene3Di2.40.128.20. 1 hit.
InterProiIPR012674. Calycin.
IPR011038. Calycin-like.
IPR000463. Fatty_acid-bd.
[Graphical view]
PRINTSiPR00178. FATTYACIDBP.
SUPFAMiSSF50814. SSF50814. 1 hit.
PROSITEiPS00214. FABP. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative promoter usage. Align

Isoform 1 (identifier: P51161-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAFTGKFEME SEKNYDEFMK LLGISSDVIE KARNFKIVTE VQQDGQDFTW
60 70 80 90 100
SQHYSGGHTM TNKFTVGKES NIQTMGGKTF KATVQMEGGK LVVNFPNYHQ
110 120
TSEIVGDKLV EVSTIGGVTY ERVSKRLA
Length:128
Mass (Da):14,371
Last modified:January 23, 2007 - v2
Checksum:i173CBC5DBEDADDE1
GO
Isoform 2 (identifier: P51161-2) [UniParc]FASTAAdd to Basket

Also known as: IBABP-L

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKTVTMMMVVEMQALTQVLRAVLSACTWVSRKGDLQRMKQTHKGKPPSSM

Show »
Length:177
Mass (Da):19,874
Checksum:i0ACBAE8E7DF65BF0
GO

Sequence cautioni

The sequence AAH22489.1 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti33 – 331R → H.1 Publication
Corresponds to variant rs17856662 [ dbSNP | Ensembl ].
VAR_039578
Natural varianti55 – 551S → Y.1 Publication
Corresponds to variant rs17852045 [ dbSNP | Ensembl ].
VAR_039579
Natural varianti79 – 791T → M.
Corresponds to variant rs1130435 [ dbSNP | Ensembl ].
VAR_039580

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MKTVTMMMVVEMQALTQVLR AVLSACTWVSRKGDLQRMKQ THKGKPPSSM in isoform 2. 1 PublicationVSP_038039

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U19869 mRNA. Translation: AAB82751.1.
X90908 mRNA. Translation: CAA62415.1.
DQ132786 mRNA. Translation: ABA12611.1.
AC008609 Genomic DNA. No translation available.
AC112191 Genomic DNA. No translation available.
BC022489 mRNA. Translation: AAH22489.1. Different initiation.
AJ250902 Genomic DNA. Translation: CAB65728.1.
CCDSiCCDS43393.1. [P51161-2]
CCDS4349.1. [P51161-1]
PIRiS63983.
RefSeqiNP_001035532.1. NM_001040442.1. [P51161-2]
NP_001124430.1. NM_001130958.1. [P51161-2]
NP_001436.1. NM_001445.2. [P51161-1]
XP_006714891.1. XM_006714828.1. [P51161-2]
XP_006714893.1. XM_006714830.1. [P51161-1]
UniGeneiHs.519719.

Genome annotation databases

EnsembliENST00000393980; ENSP00000377549; ENSG00000170231. [P51161-2]
ENST00000402432; ENSP00000385433; ENSG00000170231. [P51161-1]
GeneIDi2172.
KEGGihsa:2172.
UCSCiuc003lxx.1. human. [P51161-2]
uc003lya.1. human. [P51161-1]

Polymorphism databases

DMDMi1708457.

Keywords - Coding sequence diversityi

Alternative promoter usage, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U19869 mRNA. Translation: AAB82751.1 .
X90908 mRNA. Translation: CAA62415.1 .
DQ132786 mRNA. Translation: ABA12611.1 .
AC008609 Genomic DNA. No translation available.
AC112191 Genomic DNA. No translation available.
BC022489 mRNA. Translation: AAH22489.1 . Different initiation.
AJ250902 Genomic DNA. Translation: CAB65728.1 .
CCDSi CCDS43393.1. [P51161-2 ]
CCDS4349.1. [P51161-1 ]
PIRi S63983.
RefSeqi NP_001035532.1. NM_001040442.1. [P51161-2 ]
NP_001124430.1. NM_001130958.1. [P51161-2 ]
NP_001436.1. NM_001445.2. [P51161-1 ]
XP_006714891.1. XM_006714828.1. [P51161-2 ]
XP_006714893.1. XM_006714830.1. [P51161-1 ]
UniGenei Hs.519719.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1O1U NMR - A 2-128 [» ]
1O1V NMR - A 2-128 [» ]
2MM3 NMR - A 2-128 [» ]
ProteinModelPortali P51161.
SMRi P51161. Positions 2-128.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000377549.

PTM databases

PhosphoSitei P51161.

Polymorphism databases

DMDMi 1708457.

Proteomic databases

MaxQBi P51161.
PaxDbi P51161.
PRIDEi P51161.

Protocols and materials databases

DNASUi 2172.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000393980 ; ENSP00000377549 ; ENSG00000170231 . [P51161-2 ]
ENST00000402432 ; ENSP00000385433 ; ENSG00000170231 . [P51161-1 ]
GeneIDi 2172.
KEGGi hsa:2172.
UCSCi uc003lxx.1. human. [P51161-2 ]
uc003lya.1. human. [P51161-1 ]

Organism-specific databases

CTDi 2172.
GeneCardsi GC05P159573.
HGNCi HGNC:3561. FABP6.
HPAi CAB024713.
HPA012601.
MIMi 600422. gene.
neXtProti NX_P51161.
PharmGKBi PA27962.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG275686.
GeneTreei ENSGT00390000012034.
HOGENOMi HOG000004830.
HOVERGENi HBG005633.
InParanoidi P51161.
KOi K08755.
OMAi FKATVKM.
OrthoDBi EOG7HB5C9.
PhylomeDBi P51161.
TreeFami TF330348.

Enzyme and pathway databases

Reactomei REACT_11042. Recycling of bile acids and salts.
REACT_267716. Orphan transporters.

Miscellaneous databases

ChiTaRSi FABP6. human.
EvolutionaryTracei P51161.
GeneWikii FABP6.
GenomeRNAii 2172.
NextBioi 8771.
PROi P51161.
SOURCEi Search...

Gene expression databases

Bgeei P51161.
CleanExi HS_FABP6.
ExpressionAtlasi P51161. baseline and differential.
Genevestigatori P51161.

Family and domain databases

Gene3Di 2.40.128.20. 1 hit.
InterProi IPR012674. Calycin.
IPR011038. Calycin-like.
IPR000463. Fatty_acid-bd.
[Graphical view ]
PRINTSi PR00178. FATTYACIDBP.
SUPFAMi SSF50814. SSF50814. 1 hit.
PROSITEi PS00214. FABP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and chromosomal localization of the human ileal lipid-binding protein."
    Oelkers P., Dawson P.A.
    Biochim. Biophys. Acta 1257:199-202(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Ileum.
  2. "Molecular cloning, expression, and characterization of a human intestinal 15-kDa protein."
    Fujita M., Fujii H., Kanda T., Sato E., Hatakeyama K., Ono T.
    Eur. J. Biochem. 233:406-413(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Ileum.
  3. "A novel variant of ileal bile acid binding protein is up-regulated through nuclear factor-kappaB activation in colorectal adenocarcinoma."
    Fang C., Dean J., Smith J.W.
    Cancer Res. 67:9039-9046(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, ALTERNATIVE PROMOTER USAGE, INDUCTION, TISSUE SPECIFICITY.
  4. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS HIS-33 AND TYR-55.
    Tissue: Brain.
  6. "The human ileal bile acid binding protein gene: promoter sequence and effects of CDX2 on expression."
    Barley N.F., Shaw-Smith C.J., Chakravarty P., Howard A., Legon S., Walters J.R.
    Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-19 (ISOFORM 1).
  7. "Insights into the bile acid transportation system: the human ileal lipid-binding protein-cholyltaurine complex and its comparison with homologous structures."
    Kurz M., Brachvogel V., Matter H., Stengelin S., Thuering H., Kramer W.
    Proteins 50:312-328(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR IN COMPLEX WITH BILE ACID.

Entry informationi

Entry nameiFABP6_HUMAN
AccessioniPrimary (citable) accession number: P51161
Secondary accession number(s): Q07DR7, Q8TBI3, Q9UGI7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 23, 2007
Last modified: November 26, 2014
This is version 134 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3