P51157 (RAB28_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ras-related protein Rab-28 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 221 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Cell membrane; Lipid-anchor; Cytoplasmic side Potential. |
| Tissue specificity | Isoform S is detected in most tissues investigated: cortex, liver, kidney, skeletal muscle, adipose tissue, testis and urothelium. Isoform L is predominantly expressed in testis. |
| Sequence similarities | Belongs to the small GTPase superfamily. Rab family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Ligand | GTP-binding Nucleotide-binding |
| PTM | Acetylation Lipoprotein Methylation Phosphoprotein Prenylation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | small GTPase mediated signal transduction Inferred from electronic annotation. Source: InterPro |
| Cellular_component | plasma membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | GDP binding Inferred from direct assay Ref.8PubMed 20937701. Source: UniProtKB GTP bindingInferred from direct assay Ref.8. Source: UniProtKB GTPase activityTraceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform S (identifier: P51157-1) Also known as: Rab28S; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform L (identifier: P51157-2) Also known as: Rab28L; The sequence of this isoform differs from the canonical sequence as follows: 193-221: VVKADIVNYNQEPMSRTVNPPRSSMCAVQ → IVRAEIVKYPEEENQHTTSTQSRICSVQ | ||||||
| Isoform 3 (identifier: P51157-3) The sequence of this isoform differs from the canonical sequence as follows: 192-221: RVVKADIVNYNQEPMSRTVNPPRSSMCAVQ → GHFIIFISSTNRE | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.7 | |||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 218 | 217 | Ras-related protein Rab-28 | PRO_0000121227 | ||||||||||||||||||||||||||||||||||||||
| Propeptide | 219 – 221 | 3 | Removed in mature form Probable | PRO_0000396721 | ||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 19 – 27 | 9 | GTP | |||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 68 – 72 | 5 | GTP | |||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 129 – 132 | 4 | GTP | |||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 159 – 161 | 3 | GTP | |||||||||||||||||||||||||||||||||||||||
| Motif | 41 – 49 | 9 | Effector region By similarity | |||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylserine Ref.7 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 8 | 1 | Phosphoserine Ref.7 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 218 | 1 | Cysteine methyl ester Probable | |||||||||||||||||||||||||||||||||||||||
| Lipidation | 218 | 1 | S-farnesyl cysteine Ref.5 | |||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 192 – 221 | 30 | RVVKA…MCAVQ → GHFIIFISSTNRE in isoform 3. | VSP_045807 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 193 – 221 | 29 | VVKAD…MCAVQ → IVRAEIVKYPEEENQHTTST QSRICSVQ in isoform L. | VSP_005530 | ||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 22 | 1 | A → T in CAA64364. Ref.1 | |||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 12 – 18 | 7 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 25 – 33 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 34 – 36 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 39 – 43 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Turn | 44 – 46 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 47 – 56 | 10 | ||||||||||||||||||||||||||||||||||||||||
| Turn | 57 – 59 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 68 | 9 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 71 – 75 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 79 – 83 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 87 – 94 | 8 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 98 – 102 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 104 – 118 | 15 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 123 – 129 | 7 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 131 – 136 | 6 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 141 – 151 | 11 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 154 – 158 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Turn | 160 – 162 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 166 – 177 | 12 | ||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Alternative mRNA splicing of the novel GTPase Rab28 generates isoforms with different C-termini." Brauers A., Schuermann A., Massmann S., Muehl-Zuerbes P., Becker W., Kainulainen H., Lie C., Joost H.-G. Eur. J. Biochem. 237:833-840(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS L AND S). Tissue: Testis. |
| [2] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Puhl H.L. III, Ikeda S.R., Aronstam R.S. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM L). Tissue: Brain. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS S AND 3). Tissue: Brain and Embryonic stem cell. |
| [5] | "Towards complete sets of farnesylated and geranylgeranylated proteins." Maurer-Stroh S., Koranda M., Benetka W., Schneider G., Sirota F.L., Eisenhaber F. PLoS Comput. Biol. 3:634-648(2007) [PubMed] [Europe PMC] [Abstract] Cited for: ISOPRENYLATION AT CYS-218. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [7] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-8, MASS SPECTROMETRY, CLEAVAGE OF INITIATOR METHIONINE. |
| [8] | "Large nucleotide-dependent conformational change in Rab28." Lee S.H., Baek K., Dominguez R. FEBS Lett. 582:4107-4111(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.1 ANGSTROMS) OF 11-184 IN COMPLEX WITH GTP AND GDP ANALOGS. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X94703 mRNA. Translation: CAA64364.1. AF498955 mRNA. Translation: AAM21103.1. AC006226 Genomic DNA. No translation available. AC006445 Genomic DNA. No translation available. AC020729 Genomic DNA. No translation available. BC035054 mRNA. Translation: AAH35054.1. CX165950 mRNA. No translation available. | ||||||||||||||||||
| IPI | IPI00016377. IPI00219679. | ||||||||||||||||||
| PIR | S65477. S72399. | ||||||||||||||||||
| RefSeq | NP_001017979.1. NM_001017979.2. NP_001153073.1. NM_001159601.1. NP_004240.2. NM_004249.3. | ||||||||||||||||||
| UniGene | Hs.656060. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P51157. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P51157. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 85700393. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P51157. | ||||||||||||||||||
| PRIDE | P51157. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 9364. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000288723; ENSP00000288723; ENSG00000157869. ENST00000330852; ENSP00000328551; ENSG00000157869. ENST00000338176; ENSP00000340079; ENSG00000157869. | ||||||||||||||||||
| GeneID | 9364. | ||||||||||||||||||
| KEGG | hsa:9364. | ||||||||||||||||||
| UCSC | uc003gmt.2. human. uc003gmu.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 9364. | ||||||||||||||||||
| GeneCards | GC04M013369. | ||||||||||||||||||
| HGNC | HGNC:9768. RAB28. | ||||||||||||||||||
| HPA | HPA044575. | ||||||||||||||||||
| MIM | 612994. gene. | ||||||||||||||||||
| neXtProt | NX_P51157. | ||||||||||||||||||
| PharmGKB | PA34119. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG1100. | ||||||||||||||||||
| HOGENOM | HOG000233968. | ||||||||||||||||||
| HOVERGEN | HBG101090. | ||||||||||||||||||
| InParanoid | P51157. | ||||||||||||||||||
| KO | K07915. | ||||||||||||||||||
| OMA | CFQRIAA. | ||||||||||||||||||
| OrthoDB | EOG43R3NJ. | ||||||||||||||||||
| PhylomeDB | P51157. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P51157. | ||||||||||||||||||
| Bgee | P51157. | ||||||||||||||||||
| CleanEx | HS_RAB28. | ||||||||||||||||||
| Genevestigator | P51157. | ||||||||||||||||||
| GermOnline | ENSG00000157869. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR005225. Small_GTP-bd_dom. IPR001806. Small_GTPase. [Graphical view] | ||||||||||||||||||
| Pfam | PF00071. Ras. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00449. RASTRNSFRMNG. | ||||||||||||||||||
| TIGRFAMs | TIGR00231. small_GTP. 1 hit. | ||||||||||||||||||
| PROSITE | PS51419. RAB. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | P51157. | ||||||||||||||||||
| GenomeRNAi | 9364. | ||||||||||||||||||
| NextBio | 35067. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | RAB28_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P51157 Secondary accession number(s): G8JLC5, Q8IYR8, Q8NI05 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
