Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glycine amidinotransferase, mitochondrial

Gene

GATM

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the biosynthesis of guanidinoacetate, the immediate precursor of creatine. Creatine plays a vital role in energy metabolism in muscle tissues. May play a role in embryonic and central nervous system development. May be involved in the response to heart failure by elevating local creatine synthesis.3 Publications

Catalytic activityi

L-arginine + glycine = L-ornithine + guanidinoacetate.2 Publications

Kineticsi

  1. KM=2.0 µM for arginine2 Publications
  2. KM=3.0 µM for glycine2 Publications
  1. Vmax=0.44 µmol/min/mg enzyme2 Publications

Pathwayi: creatine biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes creatine from L-arginine and glycine.
Proteins known to be involved in the 2 steps of the subpathway in this organism are:
  1. Glycine amidinotransferase, mitochondrial (GATM)
  2. Guanidinoacetate N-methyltransferase (GAMT)
This subpathway is part of the pathway creatine biosynthesis, which is itself part of Amine and polyamine biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes creatine from L-arginine and glycine, the pathway creatine biosynthesis and in Amine and polyamine biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei2541
Active sitei3031
Active sitei407Amidino-cysteine intermediate1 Publication1

GO - Molecular functioni

  • glycine amidinotransferase activity Source: UniProtKB

GO - Biological processi

  • creatine biosynthetic process Source: MGI
  • creatine metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Enzyme and pathway databases

BioCyciMetaCyc:HS10376-MONOMER.
ZFISH:HS10376-MONOMER.
BRENDAi2.1.4.1. 2681.
ReactomeiR-HSA-71288. Creatine metabolism.
UniPathwayiUPA00104; UER00579.

Names & Taxonomyi

Protein namesi
Recommended name:
Glycine amidinotransferase, mitochondrial (EC:2.1.4.12 Publications)
Alternative name(s):
L-arginine:glycine amidinotransferase
Transamidinase
Gene namesi
Name:GATM
Synonyms:AGAT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:4175. GATM.

Subcellular locationi

Isoform 1 :

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • mitochondrial inner membrane Source: UniProtKB-SubCell
  • mitochondrial intermembrane space Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Involvement in diseasei

Cerebral creatine deficiency syndrome 3 (CCDS3)7 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disorder characterized by developmental delay/regression, mental retardation, severe disturbance of expressive and cognitive speech, and severe depletion of creatine/phosphocreatine in the brain. Most patients develop a myopathy characterized by muscle weakness and atrophy later in life.
See also OMIM:612718
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07648323R → Q in CCDS3; unknown pathological significance; reduces glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs370155767dbSNPEnsembl.1
Natural variantiVAR_07648493I → V in CCDS3; unknown pathological significance; reduces glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs34991226dbSNPEnsembl.1
Natural variantiVAR_076485102K → N in CCDS3; unknown pathological significance; reduces glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs376335787dbSNPEnsembl.1
Natural variantiVAR_076486105P → L in CCDS3; loss of glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs147804855dbSNPEnsembl.1
Natural variantiVAR_076487181E → K in CCDS3; loss of glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs376982466dbSNPEnsembl.1
Natural variantiVAR_076488185A → P in CCDS3; decreases glycine amidinotransferase activity. 2 Publications1
Natural variantiVAR_076489189R → C in CCDS3; loss of glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs377578020dbSNPEnsembl.1
Natural variantiVAR_069816203Y → S in CCDS3; loss of glycine amidinotransferase activity. 3 PublicationsCorresponds to variant rs397514709dbSNPEnsembl.1
Natural variantiVAR_076490208A → T in CCDS3; loss of glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs374059924dbSNPEnsembl.1
Natural variantiVAR_076493282R → H in CCDS3; decreases glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs371447931dbSNPEnsembl.1
Natural variantiVAR_076494329L → V in CCDS3; decreases glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs373802463dbSNPEnsembl.1
Natural variantiVAR_076495346P → L in CCDS3; decreases glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs142814307dbSNPEnsembl.1
Natural variantiVAR_071789413R → Q in CCDS3; loss of glycine amidinotransferase activity. 2 Publications1
Natural variantiVAR_071790413R → W in CCDS3; loss of glycine amidinotransferase activity. 3 Publications1
Natural variantiVAR_076496415R → Q in CCDS3; unknown pathological significance; reduces glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs374592247dbSNPEnsembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi170D → N: Complete loss of activity. 1 Publication1
Mutagenesisi233E → K: Complete loss of activity; when associated with S-407. 1 Publication1
Mutagenesisi254D → N: Significantly reduced activity. 1 Publication1
Mutagenesisi303H → V: Complete loss of activity. 1 Publication1
Mutagenesisi305D → A: Complete loss of activity. 1 Publication1
Mutagenesisi322R → E: Significantly reduced activity. 1 Publication1
Mutagenesisi355S → A: Significantly reduced activity. 1 Publication1
Mutagenesisi407C → S: Complete loss of activity; when associated with K-233. 1 Publication1
Mutagenesisi410C → A: No effect on activity. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi2628.
MalaCardsiGATM.
MIMi612718. phenotype.
OpenTargetsiENSG00000171766.
Orphaneti35704. Arginine:glycine amidinotransferase deficiency.
PharmGKBiPA28590.

Chemistry databases

DrugBankiDB00145. Glycine.
DB00129. L-Ornithine.

Polymorphism and mutation databases

BioMutaiGATM.
DMDMi1730201.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 37MitochondrionBy similarityAdd BLAST37
ChainiPRO_000000120638 – 423Glycine amidinotransferase, mitochondrialAdd BLAST386

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei46PhosphoserineCombined sources1
Modified residuei49PhosphoserineCombined sources1
Modified residuei385N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP50440.
PaxDbiP50440.
PeptideAtlasiP50440.
PRIDEiP50440.

2D gel databases

REPRODUCTION-2DPAGEIPI00032103.

PTM databases

iPTMnetiP50440.
PhosphoSitePlusiP50440.

Expressioni

Tissue specificityi

Expressed in brain, heart, kidney, liver, lung, salivary gland and skeletal muscle tissue, with the highest expression in kidney. Biallelically expressed in placenta and fetal tissues.3 Publications

Inductioni

Expression is elevated in the myocardium during heart failure, and decreased in inter-uterine growth restriction (IUGR)-associated placenta.2 Publications

Gene expression databases

BgeeiENSG00000171766.
CleanExiHS_GATM.
ExpressionAtlasiP50440. baseline and differential.
GenevisibleiP50440. HS.

Organism-specific databases

HPAiHPA026077.

Interactioni

Subunit structurei

Homodimer. There is an equilibrium between the monomeric and dimeric forms, shifted towards the side of the monomer.1 Publication

Protein-protein interaction databases

BioGridi108898. 3 interactors.
IntActiP50440. 7 interactors.
STRINGi9606.ENSP00000379895.

Structurei

Secondary structure

1423
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi70 – 73Combined sources4
Beta strandi75 – 80Combined sources6
Helixi93 – 96Combined sources4
Helixi101 – 103Combined sources3
Helixi104 – 110Combined sources7
Beta strandi113 – 115Combined sources3
Helixi117 – 136Combined sources20
Beta strandi140 – 142Combined sources3
Beta strandi152 – 154Combined sources3
Beta strandi159 – 161Combined sources3
Helixi168 – 171Combined sources4
Beta strandi172 – 176Combined sources5
Beta strandi178 – 181Combined sources4
Helixi187 – 189Combined sources3
Helixi192 – 195Combined sources4
Helixi197 – 205Combined sources9
Beta strandi209 – 212Combined sources4
Helixi220 – 222Combined sources3
Helixi232 – 240Combined sources9
Beta strandi248 – 250Combined sources3
Helixi255 – 257Combined sources3
Beta strandi258 – 261Combined sources4
Beta strandi264 – 267Combined sources4
Helixi275 – 285Combined sources11
Turni286 – 288Combined sources3
Beta strandi290 – 293Combined sources4
Beta strandi296 – 298Combined sources3
Turni305 – 307Combined sources3
Beta strandi308 – 312Combined sources5
Beta strandi315 – 318Combined sources4
Helixi327 – 332Combined sources6
Beta strandi336 – 338Combined sources3
Beta strandi352 – 354Combined sources3
Helixi356 – 360Combined sources5
Beta strandi363 – 366Combined sources4
Beta strandi369 – 373Combined sources5
Helixi377 – 385Combined sources9
Beta strandi389 – 393Combined sources5
Helixi396 – 399Combined sources4
Turni400 – 402Combined sources3
Turni405 – 408Combined sources4
Beta strandi409 – 415Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JDWX-ray1.90A1-423[»]
1JDXX-ray2.40A38-423[»]
2JDWX-ray2.10A1-423[»]
2JDXX-ray2.90A38-423[»]
3JDWX-ray2.40A1-423[»]
4JDWX-ray2.50A1-423[»]
5JDWX-ray2.60A38-423[»]
6JDWX-ray2.50A38-423[»]
7JDWX-ray2.37A38-423[»]
8JDWX-ray2.30A38-423[»]
9JDWX-ray2.50A38-423[»]
DisProtiDP00099.
ProteinModelPortaliP50440.
SMRiP50440.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP50440.

Family & Domainsi

Domaini

One chain folds into a compact single domain composed of repeating units, five beta-beta-alpha-beta modules, which surround the central active site.

Sequence similaritiesi

Belongs to the amidinotransferase family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiENOG410IFBR. Eukaryota.
ENOG410Y45M. LUCA.
GeneTreeiENSGT00390000011613.
HOGENOMiHOG000231593.
HOVERGENiHBG002492.
InParanoidiP50440.
KOiK00613.
OMAiRPCHQID.
OrthoDBiEOG091G07LX.
PhylomeDBiP50440.
TreeFamiTF300256.

Family and domain databases

InterProiIPR033195. AmidinoTrfase.
[Graphical view]
PANTHERiPTHR10488. PTHR10488. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P50440-1) [UniParc]FASTAAdd to basket
Also known as: Mitochondrial

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLRVRCLRGG SRGAEAVHYI GSRLGRTLTG WVQRTFQSTQ AATASSRNSC
60 70 80 90 100
AADDKATEPL PKDCPVSSYN EWDPLEEVIV GRAENACVPP FTIEVKANTY
110 120 130 140 150
EKYWPFYQKQ GGHYFPKDHL KKAVAEIEEM CNILKTEGVT VRRPDPIDWS
160 170 180 190 200
LKYKTPDFES TGLYSAMPRD ILIVVGNEII EAPMAWRSRF FEYRAYRSII
210 220 230 240 250
KDYFHRGAKW TTAPKPTMAD ELYNQDYPIH SVEDRHKLAA QGKFVTTEFE
260 270 280 290 300
PCFDAADFIR AGRDIFAQRS QVTNYLGIEW MRRHLAPDYR VHIISFKDPN
310 320 330 340 350
PMHIDATFNI IGPGIVLSNP DRPCHQIDLF KKAGWTIITP PTPIIPDDHP
360 370 380 390 400
LWMSSKWLSM NVLMLDEKRV MVDANEVPIQ KMFEKLGITT IKVNIRNANS
410 420
LGGGFHCWTC DVRRRGTLQS YLD
Length:423
Mass (Da):48,455
Last modified:October 1, 1996 - v1
Checksum:i5BEF7A8A039B70FB
GO
Isoform 2 (identifier: P50440-2) [UniParc]FASTAAdd to basket
Also known as: Cytoplasmic

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQ → MNILK

Show »
Length:391
Mass (Da):44,883
Checksum:iDA7E75BB41D91528
GO
Isoform 3 (identifier: P50440-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     388-423: ITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD → MYNK

Show »
Length:391
Mass (Da):44,943
Checksum:i692D75D4BCD1B990
GO

Sequence cautioni

The sequence BAG60595 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti98N → I in BAG60595 (PubMed:14702039).Curated1
Sequence conflicti246T → I in BAG60595 (PubMed:14702039).Curated1
Sequence conflicti384E → G in BAG58060 (PubMed:14702039).Curated1
Sequence conflicti395I → V in BAG60595 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07648323R → Q in CCDS3; unknown pathological significance; reduces glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs370155767dbSNPEnsembl.1
Natural variantiVAR_07648493I → V in CCDS3; unknown pathological significance; reduces glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs34991226dbSNPEnsembl.1
Natural variantiVAR_076485102K → N in CCDS3; unknown pathological significance; reduces glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs376335787dbSNPEnsembl.1
Natural variantiVAR_076486105P → L in CCDS3; loss of glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs147804855dbSNPEnsembl.1
Natural variantiVAR_020305110Q → H.1 PublicationCorresponds to variant rs1288775dbSNPEnsembl.1
Natural variantiVAR_076487181E → K in CCDS3; loss of glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs376982466dbSNPEnsembl.1
Natural variantiVAR_076488185A → P in CCDS3; decreases glycine amidinotransferase activity. 2 Publications1
Natural variantiVAR_076489189R → C in CCDS3; loss of glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs377578020dbSNPEnsembl.1
Natural variantiVAR_069816203Y → S in CCDS3; loss of glycine amidinotransferase activity. 3 PublicationsCorresponds to variant rs397514709dbSNPEnsembl.1
Natural variantiVAR_076490208A → T in CCDS3; loss of glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs374059924dbSNPEnsembl.1
Natural variantiVAR_076491231S → C Decreases glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs202225656dbSNPEnsembl.1
Natural variantiVAR_076492234D → G Decreases glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs146057680dbSNPEnsembl.1
Natural variantiVAR_076493282R → H in CCDS3; decreases glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs371447931dbSNPEnsembl.1
Natural variantiVAR_076494329L → V in CCDS3; decreases glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs373802463dbSNPEnsembl.1
Natural variantiVAR_076495346P → L in CCDS3; decreases glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs142814307dbSNPEnsembl.1
Natural variantiVAR_071789413R → Q in CCDS3; loss of glycine amidinotransferase activity. 2 Publications1
Natural variantiVAR_071790413R → W in CCDS3; loss of glycine amidinotransferase activity. 3 Publications1
Natural variantiVAR_076496415R → Q in CCDS3; unknown pathological significance; reduces glycine amidinotransferase activity. 1 PublicationCorresponds to variant rs374592247dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0002351 – 37MLRVR…QRTFQ → MNILK in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_039871388 – 423ITTIK…QSYLD → MYNK in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S68805 mRNA. Translation: AAB29892.1.
X86401 mRNA. Translation: CAA60153.1.
AK294995 mRNA. Translation: BAG58060.1.
AK298350 mRNA. Translation: BAG60595.1. Different initiation.
AK223585 mRNA. Translation: BAD97305.1.
AC025580 Genomic DNA. No translation available.
BC004141 mRNA. Translation: AAH04141.1.
CCDSiCCDS10122.1. [P50440-1]
PIRiS41734.
S54161.
RefSeqiNP_001473.1. NM_001482.2. [P50440-1]
UniGeneiHs.560354.
Hs.729565.
Hs.75335.

Genome annotation databases

EnsembliENST00000396659; ENSP00000379895; ENSG00000171766. [P50440-1]
ENST00000558336; ENSP00000454008; ENSG00000171766. [P50440-3]
GeneIDi2628.
KEGGihsa:2628.
UCSCiuc001zvc.4. human. [P50440-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S68805 mRNA. Translation: AAB29892.1.
X86401 mRNA. Translation: CAA60153.1.
AK294995 mRNA. Translation: BAG58060.1.
AK298350 mRNA. Translation: BAG60595.1. Different initiation.
AK223585 mRNA. Translation: BAD97305.1.
AC025580 Genomic DNA. No translation available.
BC004141 mRNA. Translation: AAH04141.1.
CCDSiCCDS10122.1. [P50440-1]
PIRiS41734.
S54161.
RefSeqiNP_001473.1. NM_001482.2. [P50440-1]
UniGeneiHs.560354.
Hs.729565.
Hs.75335.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JDWX-ray1.90A1-423[»]
1JDXX-ray2.40A38-423[»]
2JDWX-ray2.10A1-423[»]
2JDXX-ray2.90A38-423[»]
3JDWX-ray2.40A1-423[»]
4JDWX-ray2.50A1-423[»]
5JDWX-ray2.60A38-423[»]
6JDWX-ray2.50A38-423[»]
7JDWX-ray2.37A38-423[»]
8JDWX-ray2.30A38-423[»]
9JDWX-ray2.50A38-423[»]
DisProtiDP00099.
ProteinModelPortaliP50440.
SMRiP50440.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108898. 3 interactors.
IntActiP50440. 7 interactors.
STRINGi9606.ENSP00000379895.

Chemistry databases

DrugBankiDB00145. Glycine.
DB00129. L-Ornithine.

PTM databases

iPTMnetiP50440.
PhosphoSitePlusiP50440.

Polymorphism and mutation databases

BioMutaiGATM.
DMDMi1730201.

2D gel databases

REPRODUCTION-2DPAGEIPI00032103.

Proteomic databases

MaxQBiP50440.
PaxDbiP50440.
PeptideAtlasiP50440.
PRIDEiP50440.

Protocols and materials databases

DNASUi2628.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000396659; ENSP00000379895; ENSG00000171766. [P50440-1]
ENST00000558336; ENSP00000454008; ENSG00000171766. [P50440-3]
GeneIDi2628.
KEGGihsa:2628.
UCSCiuc001zvc.4. human. [P50440-1]

Organism-specific databases

CTDi2628.
DisGeNETi2628.
GeneCardsiGATM.
GeneReviewsiGATM.
HGNCiHGNC:4175. GATM.
HPAiHPA026077.
MalaCardsiGATM.
MIMi602360. gene.
612718. phenotype.
neXtProtiNX_P50440.
OpenTargetsiENSG00000171766.
Orphaneti35704. Arginine:glycine amidinotransferase deficiency.
PharmGKBiPA28590.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFBR. Eukaryota.
ENOG410Y45M. LUCA.
GeneTreeiENSGT00390000011613.
HOGENOMiHOG000231593.
HOVERGENiHBG002492.
InParanoidiP50440.
KOiK00613.
OMAiRPCHQID.
OrthoDBiEOG091G07LX.
PhylomeDBiP50440.
TreeFamiTF300256.

Enzyme and pathway databases

UniPathwayiUPA00104; UER00579.
BioCyciMetaCyc:HS10376-MONOMER.
ZFISH:HS10376-MONOMER.
BRENDAi2.1.4.1. 2681.
ReactomeiR-HSA-71288. Creatine metabolism.

Miscellaneous databases

ChiTaRSiGATM. human.
EvolutionaryTraceiP50440.
GeneWikiiGATM_(gene).
GenomeRNAii2628.
PROiP50440.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171766.
CleanExiHS_GATM.
ExpressionAtlasiP50440. baseline and differential.
GenevisibleiP50440. HS.

Family and domain databases

InterProiIPR033195. AmidinoTrfase.
[Graphical view]
PANTHERiPTHR10488. PTHR10488. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiGATM_HUMAN
AccessioniPrimary (citable) accession number: P50440
Secondary accession number(s): B4DH99, B4DPI3, Q53EQ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 2, 2016
This is version 177 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.