P50440 (GATM_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glycine amidinotransferase, mitochondrial EC=2.1.4.1 Alternative name(s): L-arginine:glycine amidinotransferase Transamidinase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 423 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the biosynthesis of guanidinoacetate, the immediate precursor of creatine. Creatine plays a vital role in energy metabolism in muscle tissues. May play a role in embryonic and central nervous system development. May be involved in the response to heart failure by elevating local creatine synthesis. Ref.10 Ref.11 Ref.12 |
| Catalytic activity | L-arginine + glycine = L-ornithine + guanidinoacetate. Ref.7 |
| Pathway | |
| Subunit structure | Homodimer. There is an equilibrium between the monomeric and dimeric forms, shifted towards the side of the monomer. Ref.7 |
| Subcellular location | Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side Potential. Cytoplasm. Note: The mitochondrial form is found in the intermembrane space probably attached to the outer side of the inner membrane. |
| Tissue specificity | Expressed in brain, heart, kidney, liver, lung, salivary gland and skeletal muscle tissue, with the highest expression in kidney. Biallelically expressed in placenta and fetal tissues. Ref.10 Ref.11 Ref.12 |
| Induction | Expression is elevated in the myocardium during heart failure, and decreased in inter-uterine growth restriction (IUGR)-associated placenta. Ref.10 Ref.11 |
| Domain | One chain folds into a compact single domain composed of repeating units, five beta-beta-alpha-beta modules, which surround the central active site. |
| Involvement in disease | Defects in GATM are the cause of arginine:glycine amidinotransferase deficiency (AGAT deficiency) [MIM:612718]. AGAT deficiency is an autosomal recessive disorder characterized by developmental delay/regression, mental retardation, severe disturbance of expressive and cognitive speech, and severe depletion of creatine/phosphocreatine in the brain. |
| Sequence similarities | Belongs to the amidinotransferase family. |
| Biophysicochemical properties | Kinetic parameters: KM=2.0 µM for arginine Ref.7 Ref.15 KM=3.0 µM for glycine Vmax=0.44 µmol/min/mg enzyme |
| Sequence caution | The sequence BAG60595.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane Mitochondrion Mitochondrion inner membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transit peptide |
| Molecular function | Transferase |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | creatine biosynthetic process Inferred from direct assay Ref.14. Source: MGI |
| Cellular component | mitochondrial inner membrane Inferred from electronic annotation. Source: UniProtKB-SubCell mitochondrial intermembrane spaceInferred from direct assay Ref.14. Source: MGI |
| Molecular function | glycine amidinotransferase activity Inferred from direct assay Ref.14. Source: MGI |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Gatm | Q9D964 | 1 | EBI-2552594,EBI-2552599 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P50440-1) Also known as: Mitochondrial; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P50440-2) Also known as: Cytoplasmic; The sequence of this isoform differs from the canonical sequence as follows: 1-37: MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQ → MNILK | ||||||
| Isoform 3 (identifier: P50440-3) The sequence of this isoform differs from the canonical sequence as follows: 388-423: ITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD → MYNK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 37 | 37 | Mitochondrion By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 38 – 423 | 386 | Glycine amidinotransferase, mitochondrial | PRO_0000001206 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 254 | 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 303 | 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 407 | 1 | Amidino-cysteine intermediate Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 385 | 1 | N6-acetyllysine Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 417 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | MLRVR…QRTFQ → MNILK in isoform 2. | VSP_000235 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 388 – 423 | 36 | ITTIK…QSYLD → MYNK in isoform 3. | VSP_039871 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 110 | 1 | Q → H. Ref.4 Corresponds to variant rs1288775 [ dbSNP | Ensembl ]. | VAR_020305 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 170 | 1 | D → N: Complete loss of activity. Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 233 | 1 | E → K: Complete loss of activity; when associated with S-407. Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 254 | 1 | D → N: Significantly reduced activity. Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 303 | 1 | H → V: Complete loss of activity. Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 305 | 1 | D → A: Complete loss of activity. Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 322 | 1 | R → E: Significantly reduced activity. Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 355 | 1 | S → A: Significantly reduced activity. Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 407 | 1 | C → S: Complete loss of activity; when associated with K-233. Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 410 | 1 | C → A: No effect on activity. Ref.15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 98 | 1 | N → I in BAG60595. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 246 | 1 | T → I in BAG60595. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 384 | 1 | E → G in BAG58060. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 395 | 1 | I → V in BAG60595. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 73 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 75 – 80 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 93 – 96 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 101 – 103 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 104 – 110 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 113 – 115 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 117 – 136 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 140 – 142 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 152 – 154 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 159 – 161 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 168 – 171 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 172 – 176 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 178 – 181 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 187 – 189 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 192 – 195 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 197 – 205 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 209 – 212 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 220 – 222 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 232 – 240 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 248 – 250 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 255 – 257 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 258 – 261 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 264 – 267 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 275 – 285 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 286 – 288 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 290 – 293 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 296 – 298 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 305 – 307 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 308 – 312 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 315 – 318 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 327 – 332 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 336 – 338 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 352 – 354 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 356 – 360 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 363 – 366 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 369 – 373 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 377 – 385 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 389 – 393 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 396 – 399 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 400 – 402 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 405 – 408 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 409 – 415 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The amino acid sequences of human and pig L-arginine:glycine amidinotransferase." Humm A., Huber R., Mann K. FEBS Lett. 339:101-107(1994) [PubMed: 8313955] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Kidney. |
| [2] | "Characterization of the human cDNA with partial homology with the gamma subunit of sodium potassium ATPase of rat, mouse, rabbit and sheep." Austruy E., Belley L., Millasot P., Junien C., Jeanpierre C. Submitted (APR-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Kidney. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Brain and Kidney. |
| [4] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT HIS-110. Tissue: Kidney. |
| [5] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed: 16572171] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle. |
| [7] | "The purification and characterization of human kidney L-arginine:glycine amidinotransferase." Gross M.D., Eggen M.A., Simon A.M., Van Pilsum J.F. Arch. Biochem. Biophys. 251:747-755(1986) [PubMed: 3800397] [Abstract] Cited for: CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, SUBUNIT. |
| [8] | "Recombinant expression and isolation of human L-arginine:glycine amidinotransferase and identification of its active-site cysteine residue." Humm A., Fritsche E., Mann K., Goehl U., Huber R. Biochem. J. 322:771-776(1997) [PubMed: 9148748] [Abstract] Cited for: ACTIVE SITE CYS-407. |
| [9] | "Structure and reaction mechanism of L-arginine:glycine amidinotransferase." Humm A., Fritsche E., Steinbacher S. Biol. Chem. 378:193-197(1997) [PubMed: 9165070] [Abstract] Cited for: REVIEW. |
| [10] | "Myocardial expression of the arginine:glycine amidinotransferase gene is elevated in heart failure and normalized after recovery: potential implications for local creatine synthesis." Cullen M.E., Yuen A.H., Felkin L.E., Smolenski R.T., Hall J.L., Grindle S., Miller L.W., Birks E.J., Yacoub M.H., Barton P.J. Circulation 114:I16-I20(2006) [PubMed: 16820567] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION. |
| [11] | "Unbalanced placental expression of imprinted genes in human intrauterine growth restriction." McMinn J., Wei M., Schupf N., Cusmai J., Johnson E.B., Smith A.C., Weksberg R., Thaker H.M., Tycko B. Placenta 27:540-549(2006) [PubMed: 16125225] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INDUCTION. |
| [12] | "Limited evolutionary conservation of imprinting in the human placenta." Monk D., Arnaud P., Apostolidou S., Hills F.A., Kelsey G., Stanier P., Feil R., Moore G.E. Proc. Natl. Acad. Sci. U.S.A. 103:6623-6628(2006) [PubMed: 16614068] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [13] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-385, MASS SPECTROMETRY. |
| [14] | "Crystal structure and mechanism of human L-arginine:glycine amidinotransferase: a mitochondrial enzyme involved in creatine biosynthesis." Humm A., Fritsche E., Steinbacher S., Huber R. EMBO J. 16:3373-3385(1997) [PubMed: 9218780] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 38-423. Tissue: Kidney. |
| [15] | "Substrate binding and catalysis by L-arginine:glycine amidinotransferase--a mutagenesis and crystallographic study." Fritsche E., Humm A., Huber R. Eur. J. Biochem. 247:483-490(1997) [PubMed: 9266688] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.36 ANGSTROMS) OF MUTANTS ASN-170; ASN-254 AND SER-407, BIOPHYSICOCHEMICAL PROPERTIES, REACTION MECHANISM, MUTAGENESIS OF ASP-170; GLU-233; ASP-254; HIS-303; ASP-305; ARG-322; SER-355; CYS-407 AND CYS-410. |
| [16] | "The ligand-induced structural changes of human L-arginine:glycine amidinotransferase. A mutational and crystallographic study." Fritsche E., Humm A., Huber R. J. Biol. Chem. 274:3026-3032(1999) [PubMed: 9915841] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 38-423. |
| [17] | "Arginine:glycine amidinotransferase deficiency: the third inborn error of creatine metabolism in humans." Item C.B., Stockler-Ipsiroglu S., Stromberger C., Muhl A., Alessandri M.G., Bianchi M.C., Tosetti M., Fornai F., Cioni G. Am. J. Hum. Genet. 69:1127-1133(2001) [PubMed: 11555793] [Abstract] Cited for: INVOLVEMENT IN AGAT DEFICIENCY. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | S68805 mRNA. Translation: AAB29892.1. X86401 mRNA. Translation: CAA60153.1. AK294995 mRNA. Translation: BAG58060.1. AK298350 mRNA. Translation: BAG60595.1. Different initiation. AK223585 mRNA. Translation: BAD97305.1. AC025580 Genomic DNA. No translation available. BC004141 mRNA. Translation: AAH04141.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00032103. IPI00216279. IPI00970843. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S41734. S54161. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001473.1. NM_001482.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.75335. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P50440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | P50440. Positions 64-423. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DisProt | DP00099. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P50440. 6 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | P50440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P50440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 1730201. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| REPRODUCTION-2DPAGE | IPI00032103. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P50440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000396659; ENSP00000379895; ENSG00000171766. ENST00000432007; ENSP00000388809; ENSG00000171766. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 2628. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:2628. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001zvb.1. human. uc001zvc.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 2628. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC15M045653. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0012208. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:4175. GATM. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA026077. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602360. gene. 612718. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P50440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 35704. Arginine:glycine amidinotransferase deficiency. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA28590. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG13437. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000011613. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG002492. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P50440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4C2H9H. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P50440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.1.4.1. 2681. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P50440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P50440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_GATM. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P50440. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000171766. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K00613. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00148. Creatine. DB00145. Glycine. DB00129. L-Ornithine. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 10353. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | GATM_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P50440 Secondary accession number(s): B4DH99, B4DPI3, Q53EQ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with