P50224 (ST1A3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 122.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sulfotransferase 1A3/1A4 Short name=ST1A3/ST1A4 EC=2.8.2.1 Alternative name(s): Aryl sulfotransferase 1A3/1A4 Catecholamine-sulfating phenol sulfotransferase HAST3 M-PST Monoamine-sulfating phenol sulfotransferase Placental estrogen sulfotransferase Sulfotransferase, monoamine-preferring Thermolabile phenol sulfotransferase Short name=TL-PST | |||||||
| Gene names |
| |||||||
| Organism | Homo sapiens (Human) | |||||||
| Taxonomic identifier | 9606 [NCBI] | |||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 295 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs. |
| Catalytic activity | 3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate. |
| Subunit structure | Homodimer. |
| Subcellular location | |
| Tissue specificity | Liver, colon, kidney, lung, brain, spleen, small intestine, placenta and leukocyte. |
| Post-translational modification | The N-terminus is blocked. |
| Sequence similarities | Belongs to the sulfotransferase 1 family. |
| Sequence caution | Isoform 2: The sequence BAC85507.1 differs from that shown. Reason: Frameshift at position 101. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Catecholamine metabolism Lipid metabolism Steroid metabolism |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Transferase |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | 3'-phosphoadenosine 5'-phosphosulfate metabolic process Traceable author statement. Source: Reactome catecholamine metabolic processInferred from electronic annotation. Source: UniProtKB-KW flavonoid metabolic processInferred from direct assay. Source: BHF-UCL steroid metabolic processInferred from electronic annotation. Source: UniProtKB-KW sulfationInferred from direct assay. Source: BHF-UCL xenobiotic metabolic processInferred from direct assay. Source: BHF-UCL |
| Cellular component | cytosol Traceable author statement. Source: Reactome |
| Molecular function | aryl sulfotransferase activity Traceable author statement. Source: Reactome |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P50224-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P50224-2) The sequence of this isoform differs from the canonical sequence as follows: 167-295: VSYGSWYQHV...GCSLSFRSEL → GGLDWRKEGVKPRGGGYNVQQPCVGAPCPLL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 295 | 295 | Sulfotransferase 1A3/1A4 | PRO_0000085159 | ||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 48 – 53 | 6 | PAPS By similarity | |||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 130 – 138 | 9 | PAPS By similarity | |||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 193 – 229 | 37 | PAPS By similarity | |||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 257 – 259 | 3 | PAPS By similarity | |||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 108 | 1 | Proton acceptor By similarity | |||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 167 – 295 | 129 | VSYGS…FRSEL → GGLDWRKEGVKPRGGGYNVQ QPCVGAPCPLL in isoform 2. | VSP_012326 | ||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 220 – 225 | 6 | MDFMVQ → VDLMVE in AAC99987. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 235 | 1 | N → T in AAC99987. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 244 – 245 | 2 | PQ → RR in AAC99987. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 290 | 1 | S → T in AAC99987. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 12 – 15 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 18 – 21 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 22 – 27 | 6 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 30 – 33 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 41 – 45 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 51 – 62 | 12 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 95 – 98 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 104 – 107 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 111 – 113 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 116 – 120 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 124 – 129 | 6 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 132 – 145 | 14 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 155 – 163 | 9 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 172 – 182 | 11 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 183 – 185 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 188 – 192 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 193 – 198 | 6 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 211 | 12 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 264 – 266 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 270 – 283 | 14 | ||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of two human brain aryl sulfotransferase cDNAs." Zhu X., Veronese M.E., Bernard C.C., Sansom L.N., McManus M.E. Biochem. Biophys. Res. Commun. 195:120-127(1993) [PubMed: 8363592] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Cloning and expression of cDNA encoding human placental estrogen sulfotransferase." Bernier F., Lopez-Solache I., Labrie F., Luu-The V. Mol. Cell. Endocrinol. 99:R11-R15(1994) [PubMed: 8187949] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [3] | "Genomic organization and DNA sequence of the human catecholamine-sulfating phenol sulfotransferase gene (STM)." Dooley T.P., Probst P., Munroe P.B., Mole S.E., Liu Z., Doggett N.A. Biochem. Biophys. Res. Commun. 205:1325-1332(1994) [PubMed: 7802665] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [4] | "Human liver thermolabile phenol sulfotransferase: cDNA cloning, expression and characterization." Wood T.C., Aksoy I.A., Aksoy S., Weinshilboum R.M. Biochem. Biophys. Res. Commun. 198:1119-1127(1994) [PubMed: 8117269] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 84-101. Tissue: Liver. |
| [5] | "Human thermolabile phenol sulfotransferase gene (STM): molecular cloning and structural characterization." Aksoy I.A., Weinshilboum R.M. Biochem. Biophys. Res. Commun. 208:786-795(1995) [PubMed: 7695637] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). Tissue: Platelet. |
| [6] | "Human platelet phenolsulfotransferases: cDNA cloning, stable expression in V79 cells and identification of a novel allelic variant of the phenol-sulfating form." Jones A.L., Hagen M., Coughtrie M.W.H., Roberts R.C., Glatt H. Biochem. Biophys. Res. Commun. 208:855-862(1995) [PubMed: 7695643] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Blood. |
| [7] | "Structure of human estrogen and aryl sulfotransferase gene. Two mRNA species issued from a single gene." Bernier F., Leblanc G., Labrie F., Luu-The V. J. Biol. Chem. 269:28200-28205(1994) [PubMed: 7961757] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). Tissue: Leukocyte. |
| [8] | Gaedigk A., Grant D.M. Submitted (AUG-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [9] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lung. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Pancreas. |
| [11] | "Thermolabile phenol sulfotransferase gene (STM): localization to human chromosome 16p11.2." Aksoy I.A., Callen D.F., Apostolou S., Her C., Weinshilboum R.M. Genomics 23:275-277(1994) [PubMed: 7829089] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 139-198. Tissue: Lymphocyte. |
| [12] | "Functional characterization of two human sulphotransferase cDNAs that encode monoamine- and phenol-sulphating forms of phenol sulphotransferase: substrate kinetics, thermal-stability and inhibitor-sensitivity studies." Veronese M.E., Burgess W., Zhu X., McManus M.E. Biochem. J. 302:497-502(1994) [PubMed: 8093002] [Abstract] Cited for: CHARACTERIZATION. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "Crystal structure of human catecholamine sulfotransferase." Bidwell L.M., McManus M.E., Gaedigk A., Kakuta Y., Negishi M., Pedersen L., Martin J.L. J. Mol. Biol. 293:521-530(1999) [PubMed: 10543947] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L19956 mRNA. Translation: AAA02943.1. L25275 mRNA. Translation: AAA36523.1. U08032 mRNA. Translation: AAA17723.1. U20499 Genomic DNA. Translation: AAA64490.1. X84653 mRNA. Translation: CAA59146.1. L34160 Genomic DNA. No translation available. U37686 Genomic DNA. Translation: AAA86536.1. U34199 mRNA. Translation: AAC99987.1. AK122733 mRNA. Translation: BAC85507.1. Frameshift. AK298073 mRNA. Translation: BAG60362.1. BC014471 mRNA. Translation: AAH14471.1. BC078144 mRNA. Translation: AAH78144.1. U08099 Genomic DNA. Translation: AAA82126.1. | ||||||||||||||||||
| IPI | IPI00030730. IPI00446834. | ||||||||||||||||||
| PIR | A55451. | ||||||||||||||||||
| RefSeq | NP_001017390.1. NM_001017390.2. NP_808220.1. NM_177552.3. | ||||||||||||||||||
| UniGene | Hs.460558. Hs.728806. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P50224. | ||||||||||||||||||
| SMR | P50224. Positions 9-295. | ||||||||||||||||||
| DisProt | DP00011. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| STRING | P50224. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P50224. | ||||||||||||||||||
2D gel databases | |||||||||||||||||||
| OGP | P50224. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P50224. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000338971; ENSP00000343645; ENSG00000213599. ENST00000344620; ENSP00000339221; ENSG00000213648. ENST00000360423; ENSP00000353600; ENSG00000213648. ENST00000395137; ENSP00000378569; ENSG00000213599. ENST00000395138; ENSP00000378570; ENSG00000213599. | ||||||||||||||||||
| GeneID | 445329. 6818. | ||||||||||||||||||
| KEGG | hsa:445329. hsa:6818. | ||||||||||||||||||
| UCSC | uc002dsu.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 445329. 6818. | ||||||||||||||||||
| GeneCards | GC16P029466. GC16P030206. | ||||||||||||||||||
| H-InvDB | HIX0023501. | ||||||||||||||||||
| HGNC | HGNC:11455. SULT1A3. HGNC:30004. SULT1A4. | ||||||||||||||||||
| HPA | CAB008594. | ||||||||||||||||||
| MIM | 600641. gene. | ||||||||||||||||||
| neXtProt | NX_P50224. | ||||||||||||||||||
| PharmGKB | PA344. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG05526. | ||||||||||||||||||
| HOVERGEN | HBG001195. | ||||||||||||||||||
| OMA | WIENFIF. | ||||||||||||||||||
| OrthoDB | EOG4255T9. | ||||||||||||||||||
| PhylomeDB | P50224. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BioCyc | MetaCyc:ENSG00000132207-MONOMER. | ||||||||||||||||||
| BRENDA | 2.8.2.1. 2681. | ||||||||||||||||||
| Reactome | REACT_111217. Metabolism. REACT_15380. Diabetes pathways. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P50224. | ||||||||||||||||||
| Bgee | P50224. | ||||||||||||||||||
| CleanEx | HS_SULT1A3. HS_SULT1A4. | ||||||||||||||||||
| Genevestigator | P50224. | ||||||||||||||||||
| GermOnline | ENSG00000132207. Homo sapiens. ENSG00000181625. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000863. Sulfotransferase_dom. [Graphical view] | ||||||||||||||||||
| KO | K01014. | ||||||||||||||||||
| Pfam | PF00685. Sulfotransfer_1. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| NextBio | 111370. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | ST1A3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P50224 Secondary accession number(s): B4DNV0, O95603, Q6ZWJ5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with