Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Selenide, water dikinase 1

Gene

SEPHS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Synthesizes selenophosphate from selenide and ATP.1 Publication

Caution

The conserved active site Cys (or selenocysteine) residue in position 29 is replaced by a Thr. However, as function in selenoprotein synthesis is proven, it is possible Cys-31 is the active site.Curated

Catalytic activityi

ATP + selenide + H2O = AMP + selenophosphate + phosphate.

Enzyme regulationi

Activated by phosphate ions and by potassium ions.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei31Sequence analysis1
Binding sitei32ATP1
Sitei32Important for catalytic activityBy similarity1
Binding sitei87ATP1
Binding sitei110ATP1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi67 – 69ATP3
Nucleotide bindingi162 – 164ATP; shared with dimeric partner3
Nucleotide bindingi267 – 273ATP7

GO - Molecular functioni

  • ATP binding Source: ProtInc
  • GTP binding Source: ProtInc
  • identical protein binding Source: IntAct
  • protein heterodimerization activity Source: UniProtKB
  • protein homodimerization activity Source: UniProtKB
  • selenide, water dikinase activity Source: UniProtKB-EC

GO - Biological processi

  • cellular protein modification process Source: ProtInc
  • selenocysteine biosynthetic process Source: InterPro

Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding, Selenium

Enzyme and pathway databases

BRENDAi2.7.9.3 2681

Names & Taxonomyi

Protein namesi
Recommended name:
Selenide, water dikinase 1 (EC:2.7.9.3)
Alternative name(s):
Selenium donor protein 1
Selenophosphate synthase 1
Gene namesi
Name:SEPHS1
Synonyms:SELD, SPS, SPS1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000086475.14
HGNCiHGNC:19685 SEPHS1
MIMi600902 gene
neXtProtiNX_P49903

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi85T → A: Strongly reduced ADP hydrolysis. 1 Publication1
Mutagenesisi268G → C: No change in ATP-binding. 1 Publication1
Mutagenesisi270G → R: No change in ATP-binding. 1 Publication1
Mutagenesisi273G → A, D or V: Loss of ATP-binding. 1 Publication1
Mutagenesisi274H → N: Reduced ATP-binding. 1 Publication1
Mutagenesisi274H → Y: Increased ATP-binding. 1 Publication1

Organism-specific databases

DisGeNETi22929
OpenTargetsiENSG00000086475
PharmGKBiPA134905215

Polymorphism and mutation databases

BioMutaiSEPHS1
DMDMi27151792

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001276482 – 392Selenide, water dikinase 1Add BLAST391

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP49903
MaxQBiP49903
PaxDbiP49903
PeptideAtlasiP49903
PRIDEiP49903

PTM databases

iPTMnetiP49903
PhosphoSitePlusiP49903

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are gradually expressed during the cell cycle until G2/M phase and then decreased. Isoform 3 is gradually expressed during the cell cycle until S phase and then decreased.1 Publication

Gene expression databases

BgeeiENSG00000086475
CleanExiHS_SEPHS1
ExpressionAtlasiP49903 baseline and differential
GenevisibleiP49903 HS

Organism-specific databases

HPAiHPA037645

Interactioni

Subunit structurei

Homodimer (isoform 1, isoform 2, isoform 3 and isoform 4). Heterodimer of isoform 1 and isoform 3. Heterodimer of isoform 2 and isoform 4.2 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • protein heterodimerization activity Source: UniProtKB
  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi116589, 51 interactors
IntActiP49903, 15 interactors
MINTiP49903
STRINGi9606.ENSP00000367893

Structurei

Secondary structure

1392
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi10 – 12Combined sources3
Helixi20 – 23Combined sources4
Helixi35 – 42Combined sources8
Beta strandi68 – 74Combined sources7
Beta strandi81 – 89Combined sources9
Helixi96 – 113Combined sources18
Beta strandi120 – 129Combined sources10
Helixi134 – 154Combined sources21
Beta strandi159 – 169Combined sources11
Beta strandi171 – 180Combined sources10
Helixi182 – 184Combined sources3
Beta strandi196 – 201Combined sources6
Helixi205 – 213Combined sources9
Helixi218 – 224Combined sources7
Helixi230 – 245Combined sources16
Helixi249 – 257Combined sources9
Beta strandi262 – 265Combined sources4
Helixi270 – 279Combined sources10
Beta strandi283 – 296Combined sources14
Helixi299 – 305Combined sources7
Turni306 – 308Combined sources3
Helixi312 – 314Combined sources3
Beta strandi324 – 328Combined sources5
Helixi330 – 341Combined sources12
Beta strandi352 – 362Combined sources11
Beta strandi364 – 375Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3FD5X-ray1.90A/B1-392[»]
3FD6X-ray1.95A/B1-392[»]
ProteinModelPortaliP49903
SMRiP49903
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP49903

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3939 Eukaryota
COG0709 LUCA
GeneTreeiENSGT00390000000950
HOGENOMiHOG000219301
HOVERGENiHBG001207
InParanoidiP49903
KOiK01008
OMAiGCIPGGT
OrthoDBiEOG091G0B7N
PhylomeDBiP49903
TreeFamiTF313811

Family and domain databases

CDDicd02195 SelD, 1 hit
Gene3Di3.30.1330.10, 1 hit
3.90.650.10, 2 hits
InterProiView protein in InterPro
IPR010918 PurM-like_C_dom
IPR036676 PurM-like_C_sf
IPR016188 PurM-like_N
IPR036921 PurM-like_N_sf
IPR023061 SelD_I
IPR004536 SPS/SelD
PANTHERiPTHR10256 PTHR10256, 1 hit
PfamiView protein in Pfam
PF00586 AIRS, 1 hit
PF02769 AIRS_C, 1 hit
PIRSFiPIRSF036407 Selenphspht_syn, 1 hit
SUPFAMiSSF55326 SSF55326, 1 hit
SSF56042 SSF56042, 1 hit
TIGRFAMsiTIGR00476 selD, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P49903-1) [UniParc]FASTAAdd to basket
Also known as: Major type, MT

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTRESFNPE SYELDKSFRL TRFTELKGTG CKVPQDVLQK LLESLQENHF
60 70 80 90 100
QEDEQFLGAV MPRLGIGMDT CVIPLRHGGL SLVQTTDYIY PIVDDPYMMG
110 120 130 140 150
RIACANVLSD LYAMGVTECD NMLMLLGVSN KMTDRERDKV MPLIIQGFKD
160 170 180 190 200
AAEEAGTSVT GGQTVLNPWI VLGGVATTVC QPNEFIMPDN AVPGDVLVLT
210 220 230 240 250
KPLGTQVAVA VHQWLDIPEK WNKIKLVVTQ EDVELAYQEA MMNMARLNRT
260 270 280 290 300
AAGLMHTFNA HAATDITGFG ILGHAQNLAK QQRNEVSFVI HNLPVLAKMA
310 320 330 340 350
AVSKACGNMF GLMHGTCPET SGGLLICLPR EQAARFCAEI KSPKYGEGHQ
360 370 380 390
AWIIGIVEKG NRTARIIDKP RIIEVAPQVA TQNVNPTPGA TS
Length:392
Mass (Da):42,911
Last modified:December 13, 2002 - v2
Checksum:iE9636E38146D926D
GO
Isoform 2 (identifier: P49903-2) [UniParc]FASTAAdd to basket
Also known as: Delta E8

The sequence of this isoform differs from the canonical sequence as follows:
     251-321: Missing.

Show »
Length:321
Mass (Da):35,479
Checksum:i1894C5DBC991ABA8
GO
Isoform 3 (identifier: P49903-3) [UniParc]FASTAAdd to basket
Also known as: Delta E2

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.

Show »
Length:325
Mass (Da):35,208
Checksum:i6938A3EB8339E631
GO
Isoform 4 (identifier: P49903-4) [UniParc]FASTAAdd to basket
Also known as: E9 and E9a

The sequence of this isoform differs from the canonical sequence as follows:
     322-392: GGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS → DVQ

Show »
Length:324
Mass (Da):35,620
Checksum:i538F17DE5C1D3644
GO

Sequence cautioni

The sequence AAA87567 differs from that shown. Reason: Frameshift at position 377.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti260A → T in AAA87567 (PubMed:7665581).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0467011 – 67Missing in isoform 3. 2 PublicationsAdd BLAST67
Alternative sequenceiVSP_046702251 – 321Missing in isoform 2. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_047451322 – 392GGLLI…PGATS → DVQ in isoform 4. 1 PublicationAdd BLAST71

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U34044 mRNA Translation: AAA87567.1 Frameshift.
GU954545 mRNA Translation: ADF78120.1
GU954546 mRNA Translation: ADF78121.1
GU954547 mRNA Translation: ADF78122.1
GU954548 mRNA Translation: ADF78123.1
GU954549 mRNA Translation: ADF78124.1
AK301568 mRNA Translation: BAG63062.1
AL138764 Genomic DNA No translation available.
AL355870 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86289.1
CH471072 Genomic DNA Translation: EAW86290.1
CH471072 Genomic DNA Translation: EAW86291.1
CH471072 Genomic DNA Translation: EAW86292.1
CH471072 Genomic DNA Translation: EAW86293.1
BC000941 mRNA Translation: AAH00941.1
BC063816 mRNA Translation: AAH63816.1
CCDSiCCDS55702.1 [P49903-3]
CCDS55703.1 [P49903-2]
CCDS7098.1 [P49903-1]
RefSeqiNP_001182531.1, NM_001195602.1 [P49903-3]
NP_001182533.1, NM_001195604.1 [P49903-2]
NP_036379.2, NM_012247.4 [P49903-1]
XP_016871431.1, XM_017015942.1 [P49903-1]
XP_016871432.1, XM_017015943.1 [P49903-1]
XP_016871434.1, XM_017015945.1 [P49903-3]
UniGeneiHs.124027

Genome annotation databases

EnsembliENST00000327347; ENSP00000367893; ENSG00000086475 [P49903-1]
ENST00000378614; ENSP00000367877; ENSG00000086475 [P49903-2]
ENST00000545675; ENSP00000441119; ENSG00000086475 [P49903-3]
GeneIDi22929
KEGGihsa:22929
UCSCiuc001imk.4 human [P49903-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSPS1_HUMAN
AccessioniPrimary (citable) accession number: P49903
Secondary accession number(s): B4DWK0
, D3DRS9, D6PSQ9, Q5T5U8, Q5T5U9, Q9BVT4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: December 13, 2002
Last modified: May 23, 2018
This is version 158 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health