P49895 (IOD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Type I iodothyronine deiodinase EC=1.97.1.10 Alternative name(s): 5DI DIOI Type 1 DI Type-I 5'-deiodinase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 249 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine) and of T3 into T2 (3,3'-diiodothyronine). Plays a role in providing a source of plasma T3 by deiodination of T4 in peripheral tissues such as liver and kidney. |
| Catalytic activity | 3,5,3'-triiodo-L-thyronine + iodide + A + H+ = L-thyroxine + AH2. |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass membrane protein By similarity. |
| Sequence similarities | Belongs to the iodothyronine deiodinase family. |
Ontologies
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P49895-1) Also known as: a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P49895-2) Also known as: b; The sequence of this isoform differs from the canonical sequence as follows: 50-113: Missing. | ||||||
| Isoform 3 (identifier: P49895-3) Also known as: c/f; The sequence of this isoform differs from the canonical sequence as follows: 78-109: RWQRLEDTTELGGLAPNCPVVRLSGQRCNIWE → IGHWCUILEVVPDLHLCSNLTSSRGLLKTLVP 110-249: Missing. | ||||||
| Note: The UGA codon in position 83 may either function as a selenocysteine codon or a translation termination codon. | ||||||
| Isoform 4 (identifier: P49895-4) Also known as: d; The sequence of this isoform differs from the canonical sequence as follows: 113-160: Missing. | ||||||
| Isoform 5 (identifier: P49895-5) Also known as: e; The sequence of this isoform differs from the canonical sequence as follows: 161-161: D → G 162-249: Missing. | ||||||
| Isoform 6 (identifier: P49895-6) Also known as: k; The sequence of this isoform differs from the canonical sequence as follows: 26-40: GKVLLILFPDRVKRN → APSISGSSURSVGSD 41-249: Missing. | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. The UGA codon in position 34 may either function as a selenocysteine codon or a translation termination codon. | ||||||
| Isoform 7 (identifier: P49895-7) Also known as: l; The sequence of this isoform differs from the canonical sequence as follows: 114-249: Missing. | ||||||
| Isoform 8 (identifier: P49895-8) Also known as: m; The sequence of this isoform differs from the canonical sequence as follows: 50-85: MTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDT → PLAATRGHDUARGSGPKLPGGPPLRTEVQHLGVYAR 86-249: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. The UGA codon in position 59 may either function as a selenocysteine codon or a translation termination codon. | ||||||
| Isoform 9 (identifier: P49895-9) Also known as: s; The sequence of this isoform differs from the canonical sequence as follows: 50-89: MTRNPHFSHD...QRLEDTTELG → PLAATRGHDU...LGVYARWLGF 90-249: Missing. | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. The UGA codon in position 59 may either function as a selenocysteine codon or a translation termination codon. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 249 | 249 | Type I iodothyronine deiodinase | PRO_0000154311 | |||||
Regions | |||||||||
| Transmembrane | 13 – 33 | 21 | Helical; Potential | ||||||
Sites | |||||||||
| Active site | 126 | 1 | |||||||
Amino acid modifications | |||||||||
| Non-standard residue | 126 | 1 | Selenocysteine | ||||||
Natural variations | |||||||||
| Alternative sequence | 26 – 40 | 15 | GKVLL…RVKRN → APSISGSSURSVGSD in isoform 6. | VSP_012772 | |||||
| Alternative sequence | 41 – 249 | 209 | Missing in isoform 6. | VSP_012773 | |||||
| Alternative sequence | 50 – 113 | 64 | Missing in isoform 2. | VSP_012774 | |||||
| Alternative sequence | 50 – 89 | 40 | MTRNP…TTELG → PLAATRGHDUARGSGPKLPG GPPLRTEVQHLGVYARWLGF in isoform 9. | VSP_012779 | |||||
| Alternative sequence | 50 – 85 | 36 | MTRNP…RLEDT → PLAATRGHDUARGSGPKLPG GPPLRTEVQHLGVYAR in isoform 8. | VSP_012775 | |||||
| Alternative sequence | 78 – 109 | 32 | RWQRL…CNIWE → IGHWCUILEVVPDLHLCSNL TSSRGLLKTLVP in isoform 3. | VSP_012777 | |||||
| Alternative sequence | 86 – 249 | 164 | Missing in isoform 8. | VSP_012776 | |||||
| Alternative sequence | 90 – 249 | 160 | Missing in isoform 9. | VSP_012780 | |||||
| Alternative sequence | 110 – 249 | 140 | Missing in isoform 3. | VSP_012778 | |||||
| Alternative sequence | 113 – 160 | 48 | Missing in isoform 4. | VSP_012781 | |||||
| Alternative sequence | 114 – 249 | 136 | Missing in isoform 7. | VSP_012782 | |||||
| Alternative sequence | 161 | 1 | D → G in isoform 5. | VSP_012783 | |||||
| Alternative sequence | 162 – 249 | 88 | Missing in isoform 5. | VSP_012784 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and in vitro expression of the human selenoprotein, type I iodothyronine deiodinase." Mandel S.J., Berry M.J., Kieffer J.D., Harney J.W., Warne R.L., Larsen P.R. J. Clin. Endocrinol. Metab. 75:1133-1139(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Type I iodothyronine deiodinase splice variants in human liver." Wassen F.J.W.S., Kuiper G.G.J.M., Visser T.J. Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8 AND 9). Tissue: Liver. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5). Tissue: Kidney. |
| [5] | "A novel retinoid X receptor-independent thyroid hormone response element is present in the human type 1 deiodinase gene." Toyoda N., Zavacki A.M., Maia A.L., Harney J.W., Larsen P.R. Mol. Cell. Biol. 15:5100-5112(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-25. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Deiodinase entry |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | S48220 mRNA. Translation: AAB23670.2. AY560374 mRNA. Translation: AAT02480.1. AY560375 mRNA. Translation: AAT02481.1. AY560376 mRNA. Translation: AAT02482.1. AY560377 mRNA. Translation: AAT02483.1. AY560378 mRNA. Translation: AAT02484.1. AY560379 mRNA. Translation: AAT02485.1. AY560380 mRNA. Translation: AAT02486.1. AY560381 mRNA. Translation: AAT02487.1. AY560382 mRNA. Translation: AAT02488.1. AY560383 mRNA. Translation: AAT02489.1. AL031427 Genomic DNA. No translation available. BC017955 mRNA. Translation: AAH17955.2. BC107170 mRNA. Translation: AAI07171.1. BC107171 mRNA. Translation: AAI07172.1. S79349 Genomic DNA. Translation: AAB35380.2. |
| IPI | IPI00028634. IPI00412686. IPI00451418. IPI00451420. IPI00451421. IPI00514323. IPI00515078. IPI00552076. IPI00552688. |
| RefSeq | NP_000783.2. NM_000792.5. NP_001034804.1. NM_001039715.1. NP_001034805.1. NM_001039716.1. NP_998758.1. NM_213593.3. |
| UniGene | Hs.251415. |
3D structure databases | |
| ProteinModelPortal | P49895. |
| ModBase | Search... |
Polymorphism databases | |
| DMDM | 182702125. |
Proteomic databases | |
| PaxDb | P49895. |
| PRIDE | P49895. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000322679; ENSP00000323198; ENSG00000211452. ENST00000361921; ENSP00000354643; ENSG00000211452. ENST00000388876; ENSP00000373528; ENSG00000211452. ENST00000525202; ENSP00000435725; ENSG00000211452. ENST00000532493; ENSP00000434758; ENSG00000211452. |
| GeneID | 1733. |
| KEGG | hsa:1733. |
| UCSC | uc001cwb.3. human. uc009vzl.3. human. uc021onp.1. human. uc021onq.1. human. uc021onr.1. human. |
Organism-specific databases | |
| CTD | 1733. |
| GeneCards | GC01P054359. |
| HGNC | HGNC:2883. DIO1. |
| MIM | 147892. gene+phenotype. |
| neXtProt | NX_P49895. |
| PharmGKB | PA27337. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG67608. |
| HOVERGEN | HBG000099. |
| InParanoid | P49895. |
| KO | K01562. |
| OMA | NHQNLQD. |
| PhylomeDB | P49895. |
Enzyme and pathway databases | |
| BRENDA | 1.97.1.10. 2681. |
| Reactome | REACT_111217. Metabolism. |
| SABIO-RK | P49895. |
Gene expression databases | |
| ArrayExpress | P49895. |
| Bgee | P49895. |
| Genevestigator | P49895. |
| GermOnline | ENSG00000181150. Homo sapiens. ENSG00000211452. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.30.10. 1 hit. |
| InterPro | IPR000643. Iodothyronine_deiodinase. IPR008261. Iodothyronine_deiodinase_AS. IPR027252. Iodothyronine_deiodinase_I/III. IPR012336. Thioredoxin-like_fold. [Graphical view] |
| PANTHER | PTHR11781. PTHR11781. 1 hit. |
| Pfam | PF00837. T4_deiodinase. 1 hit. [Graphical view] |
| PIRSF | PIRSF001330. IOD. 1 hit. PIRSF500144. IODI_III. 1 hit. |
| PROSITE | PS01205. T4_DEIODINASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL2019. |
| GenomeRNAi | 1733. |
| NextBio | 7017. |
| SOURCE | Search... |
Entry information
| Entry name | IOD1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P49895 Secondary accession number(s): Q1RN02 Q8WWC6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
