Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P49895

- IOD1_HUMAN

UniProt

P49895 - IOD1_HUMAN

Protein

Type I iodothyronine deiodinase

Gene

DIO1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 136 (01 Oct 2014)
      Sequence version 3 (26 Feb 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine) and of T3 into T2 (3,3'-diiodothyronine). Plays a role in providing a source of plasma T3 by deiodination of T4 in peripheral tissues such as liver and kidney.

    Catalytic activityi

    3,5,3'-triiodo-L-thyronine + iodide + A + H+ = L-thyroxine + AH2.PROSITE-ProRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei126 – 1261

    GO - Molecular functioni

    1. selenium binding Source: ProtInc
    2. thyroxine 5'-deiodinase activity Source: ProtInc

    GO - Biological processi

    1. cellular nitrogen compound metabolic process Source: Reactome
    2. hormone biosynthetic process Source: UniProtKB-KW
    3. small molecule metabolic process Source: Reactome
    4. thyroid hormone generation Source: Reactome

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Thyroid hormones biosynthesis

    Enzyme and pathway databases

    BRENDAi1.97.1.10. 2681.
    ReactomeiREACT_15297. Regulation of thyroid hormone activity.
    SABIO-RKP49895.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Type I iodothyronine deiodinase (EC:1.97.1.10)
    Alternative name(s):
    5DI
    DIOI
    Type 1 DI
    Type-I 5'-deiodinase
    Gene namesi
    Name:DIO1
    Synonyms:ITDI1, TXDI1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:2883. DIO1.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW
    3. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Organism-specific databases

    MIMi147892. gene+phenotype.
    PharmGKBiPA27337.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 249249Type I iodothyronine deiodinasePRO_0000154311Add
    BLAST

    Proteomic databases

    PaxDbiP49895.
    PRIDEiP49895.

    Expressioni

    Gene expression databases

    ArrayExpressiP49895.
    BgeeiP49895.
    GenevestigatoriP49895.

    Structurei

    3D structure databases

    ProteinModelPortaliP49895.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei13 – 3321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the iodothyronine deiodinase family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG67608.
    HOVERGENiHBG000099.
    InParanoidiP49895.
    KOiK01562.
    OMAiRCNIWEF.
    PhylomeDBiP49895.
    TreeFamiTF329721.

    Family and domain databases

    Gene3Di3.40.30.10. 1 hit.
    InterProiIPR000643. Iodothyronine_deiodinase.
    IPR008261. Iodothyronine_deiodinase_AS.
    IPR027252. Iodothyronine_deiodinase_I/III.
    IPR012336. Thioredoxin-like_fold.
    [Graphical view]
    PANTHERiPTHR11781. PTHR11781. 1 hit.
    PfamiPF00837. T4_deiodinase. 1 hit.
    [Graphical view]
    PIRSFiPIRSF001330. IOD. 1 hit.
    PIRSF500144. IODI_III. 1 hit.
    SUPFAMiSSF52833. SSF52833. 1 hit.
    PROSITEiPS01205. T4_DEIODINASE. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P49895-1) [UniParc]FASTAAdd to Basket

    Also known as: a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGLPQPGLWL KRLWVLLEVA VHVVVGKVLL ILFPDRVKRN ILAMGEKTGM    50
    TRNPHFSHDN WIPTFFSTQY FWFVLKVRWQ RLEDTTELGG LAPNCPVVRL 100
    SGQRCNIWEF MQGNRPLVLN FGSCTUPSFM FKFDQFKRLI EDFSSIADFL 150
    VIYIEEAHAS DGWAFKNNMD IRNHQNLQDR LQAAHLLLAR SPQCPVVVDT 200
    MQNQSSQLYA ALPERLYIIQ EGRILYKGKS GPWNYNPEEV RAVLEKLHS 249
    Length:249
    Mass (Da):28,924
    Last modified:February 26, 2008 - v3
    Checksum:i2D8BBFBA54B5A927
    GO
    Isoform 2 (identifier: P49895-2) [UniParc]FASTAAdd to Basket

    Also known as: b

    The sequence of this isoform differs from the canonical sequence as follows:
         50-113: Missing.

    Show »
    Length:185
    Mass (Da):21,252
    Checksum:i91E53DDDFC99E838
    GO
    Isoform 3 (identifier: P49895-3) [UniParc]FASTAAdd to Basket

    Also known as: c/f

    The sequence of this isoform differs from the canonical sequence as follows:
         78-109: RWQRLEDTTELGGLAPNCPVVRLSGQRCNIWE → IGHWCUILEVVPDLHLCSNLTSSRGLLKTLVP
         110-249: Missing.

    Note: The UGA codon in position 83 may either function as a selenocysteine codon or a translation termination codon.

    Show »
    Length:109
    Mass (Da):12,581
    Checksum:i11293D50D43993E9
    GO
    Isoform 4 (identifier: P49895-4) [UniParc]FASTAAdd to Basket

    Also known as: d

    The sequence of this isoform differs from the canonical sequence as follows:
         113-160: Missing.

    Show »
    Length:201
    Mass (Da):23,390
    Checksum:i04CBA7E9DFCC49FF
    GO
    Isoform 5 (identifier: P49895-5) [UniParc]FASTAAdd to Basket

    Also known as: e

    The sequence of this isoform differs from the canonical sequence as follows:
         161-161: D → G
         162-249: Missing.

    Show »
    Length:161
    Mass (Da):18,712
    Checksum:i925FC41D8C359953
    GO
    Isoform 6 (identifier: P49895-6) [UniParc]FASTAAdd to Basket

    Also known as: k

    The sequence of this isoform differs from the canonical sequence as follows:
         26-40: GKVLLILFPDRVKRN → APSISGSSURSVGSD
         41-249: Missing.

    Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. The UGA codon in position 34 may either function as a selenocysteine codon or a translation termination codon.

    Show »
    Length:40
    Mass (Da):4,292
    Checksum:i0C907B0BF69B85FE
    GO
    Isoform 7 (identifier: P49895-7) [UniParc]FASTAAdd to Basket

    Also known as: l

    The sequence of this isoform differs from the canonical sequence as follows:
         114-249: Missing.

    Show »
    Length:113
    Mass (Da):13,178
    Checksum:i4C437DDA41E76153
    GO
    Isoform 8 (identifier: P49895-8) [UniParc]FASTAAdd to Basket

    Also known as: m

    The sequence of this isoform differs from the canonical sequence as follows:
         50-85: MTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDT → PLAATRGHDUARGSGPKLPGGPPLRTEVQHLGVYAR
         86-249: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. The UGA codon in position 59 may either function as a selenocysteine codon or a translation termination codon.

    Show »
    Length:85
    Mass (Da):9,270
    Checksum:i3885B86A586951FC
    GO
    Isoform 9 (identifier: P49895-9) [UniParc]FASTAAdd to Basket

    Also known as: s

    The sequence of this isoform differs from the canonical sequence as follows:
         50-89: MTRNPHFSHD...QRLEDTTELG → PLAATRGHDU...LGVYARWLGF
         90-249: Missing.

    Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. The UGA codon in position 59 may either function as a selenocysteine codon or a translation termination codon.

    Show »
    Length:89
    Mass (Da):9,774
    Checksum:i131E31116885B86A
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei26 – 4015GKVLL…RVKRN → APSISGSSURSVGSD in isoform 6. 1 PublicationVSP_012772Add
    BLAST
    Alternative sequencei41 – 249209Missing in isoform 6. 1 PublicationVSP_012773Add
    BLAST
    Alternative sequencei50 – 11364Missing in isoform 2. 1 PublicationVSP_012774Add
    BLAST
    Alternative sequencei50 – 8940MTRNP…TTELG → PLAATRGHDUARGSGPKLPG GPPLRTEVQHLGVYARWLGF in isoform 9. 1 PublicationVSP_012779Add
    BLAST
    Alternative sequencei50 – 8536MTRNP…RLEDT → PLAATRGHDUARGSGPKLPG GPPLRTEVQHLGVYAR in isoform 8. 1 PublicationVSP_012775Add
    BLAST
    Alternative sequencei78 – 10932RWQRL…CNIWE → IGHWCUILEVVPDLHLCSNL TSSRGLLKTLVP in isoform 3. 1 PublicationVSP_012777Add
    BLAST
    Alternative sequencei86 – 249164Missing in isoform 8. 1 PublicationVSP_012776Add
    BLAST
    Alternative sequencei90 – 249160Missing in isoform 9. 1 PublicationVSP_012780Add
    BLAST
    Alternative sequencei110 – 249140Missing in isoform 3. 1 PublicationVSP_012778Add
    BLAST
    Alternative sequencei113 – 16048Missing in isoform 4. 1 PublicationVSP_012781Add
    BLAST
    Alternative sequencei114 – 249136Missing in isoform 7. 1 PublicationVSP_012782Add
    BLAST
    Alternative sequencei161 – 1611D → G in isoform 5. 2 PublicationsVSP_012783
    Alternative sequencei162 – 24988Missing in isoform 5. 2 PublicationsVSP_012784Add
    BLAST

    Non-standard residue

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Non-standard residuei126 – 1261Selenocysteine

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S48220 mRNA. Translation: AAB23670.2.
    AY560374 mRNA. Translation: AAT02480.1.
    AY560375 mRNA. Translation: AAT02481.1.
    AY560376 mRNA. Translation: AAT02482.1.
    AY560377 mRNA. Translation: AAT02483.1.
    AY560378 mRNA. Translation: AAT02484.1.
    AY560379 mRNA. Translation: AAT02485.1.
    AY560380 mRNA. Translation: AAT02486.1.
    AY560381 mRNA. Translation: AAT02487.1.
    AY560382 mRNA. Translation: AAT02488.1.
    AY560383 mRNA. Translation: AAT02489.1.
    AL031427 Genomic DNA. No translation available.
    BC017955 mRNA. Translation: AAH17955.2.
    BC107170 mRNA. Translation: AAI07171.1.
    BC107171 mRNA. Translation: AAI07172.1.
    S79349 Genomic DNA. Translation: AAB35380.2.
    CCDSiCCDS30722.1. [P49895-4]
    CCDS41339.1. [P49895-1]
    CCDS41340.1. [P49895-5]
    CCDS53320.1. [P49895-2]
    RefSeqiNP_000783.2. NM_000792.5. [P49895-1]
    NP_001034804.1. NM_001039715.1. [P49895-4]
    NP_001034805.1. NM_001039716.1. [P49895-5]
    NP_998758.1. NM_213593.3. [P49895-2]
    UniGeneiHs.251415.

    Genome annotation databases

    EnsembliENST00000322679; ENSP00000323198; ENSG00000211452. [P49895-5]
    ENST00000361921; ENSP00000354643; ENSG00000211452. [P49895-1]
    ENST00000388876; ENSP00000373528; ENSG00000211452. [P49895-4]
    ENST00000525202; ENSP00000435725; ENSG00000211452. [P49895-2]
    ENST00000532493; ENSP00000434758; ENSG00000211452. [P49895-7]
    GeneIDi1733.
    KEGGihsa:1733.
    UCSCiuc001cwb.3. human. [P49895-4]
    uc009vzl.3. human. [P49895-7]
    uc021onp.1. human. [P49895-2]
    uc021onq.1. human. [P49895-1]
    uc021onr.1. human. [P49895-5]

    Polymorphism databases

    DMDMi182702125.

    Keywords - Coding sequence diversityi

    Alternative splicing, Selenocysteine

    Cross-referencesi

    Web resourcesi

    Wikipedia

    Deiodinase entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S48220 mRNA. Translation: AAB23670.2 .
    AY560374 mRNA. Translation: AAT02480.1 .
    AY560375 mRNA. Translation: AAT02481.1 .
    AY560376 mRNA. Translation: AAT02482.1 .
    AY560377 mRNA. Translation: AAT02483.1 .
    AY560378 mRNA. Translation: AAT02484.1 .
    AY560379 mRNA. Translation: AAT02485.1 .
    AY560380 mRNA. Translation: AAT02486.1 .
    AY560381 mRNA. Translation: AAT02487.1 .
    AY560382 mRNA. Translation: AAT02488.1 .
    AY560383 mRNA. Translation: AAT02489.1 .
    AL031427 Genomic DNA. No translation available.
    BC017955 mRNA. Translation: AAH17955.2 .
    BC107170 mRNA. Translation: AAI07171.1 .
    BC107171 mRNA. Translation: AAI07172.1 .
    S79349 Genomic DNA. Translation: AAB35380.2 .
    CCDSi CCDS30722.1. [P49895-4 ]
    CCDS41339.1. [P49895-1 ]
    CCDS41340.1. [P49895-5 ]
    CCDS53320.1. [P49895-2 ]
    RefSeqi NP_000783.2. NM_000792.5. [P49895-1 ]
    NP_001034804.1. NM_001039715.1. [P49895-4 ]
    NP_001034805.1. NM_001039716.1. [P49895-5 ]
    NP_998758.1. NM_213593.3. [P49895-2 ]
    UniGenei Hs.251415.

    3D structure databases

    ProteinModelPortali P49895.
    ModBasei Search...
    MobiDBi Search...

    Chemistry

    ChEMBLi CHEMBL2019.

    Polymorphism databases

    DMDMi 182702125.

    Proteomic databases

    PaxDbi P49895.
    PRIDEi P49895.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000322679 ; ENSP00000323198 ; ENSG00000211452 . [P49895-5 ]
    ENST00000361921 ; ENSP00000354643 ; ENSG00000211452 . [P49895-1 ]
    ENST00000388876 ; ENSP00000373528 ; ENSG00000211452 . [P49895-4 ]
    ENST00000525202 ; ENSP00000435725 ; ENSG00000211452 . [P49895-2 ]
    ENST00000532493 ; ENSP00000434758 ; ENSG00000211452 . [P49895-7 ]
    GeneIDi 1733.
    KEGGi hsa:1733.
    UCSCi uc001cwb.3. human. [P49895-4 ]
    uc009vzl.3. human. [P49895-7 ]
    uc021onp.1. human. [P49895-2 ]
    uc021onq.1. human. [P49895-1 ]
    uc021onr.1. human. [P49895-5 ]

    Organism-specific databases

    CTDi 1733.
    GeneCardsi GC01P054359.
    HGNCi HGNC:2883. DIO1.
    MIMi 147892. gene+phenotype.
    neXtProti NX_P49895.
    PharmGKBi PA27337.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG67608.
    HOVERGENi HBG000099.
    InParanoidi P49895.
    KOi K01562.
    OMAi RCNIWEF.
    PhylomeDBi P49895.
    TreeFami TF329721.

    Enzyme and pathway databases

    BRENDAi 1.97.1.10. 2681.
    Reactomei REACT_15297. Regulation of thyroid hormone activity.
    SABIO-RK P49895.

    Miscellaneous databases

    GenomeRNAii 1733.
    NextBioi 7017.
    PROi P49895.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P49895.
    Bgeei P49895.
    Genevestigatori P49895.

    Family and domain databases

    Gene3Di 3.40.30.10. 1 hit.
    InterProi IPR000643. Iodothyronine_deiodinase.
    IPR008261. Iodothyronine_deiodinase_AS.
    IPR027252. Iodothyronine_deiodinase_I/III.
    IPR012336. Thioredoxin-like_fold.
    [Graphical view ]
    PANTHERi PTHR11781. PTHR11781. 1 hit.
    Pfami PF00837. T4_deiodinase. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF001330. IOD. 1 hit.
    PIRSF500144. IODI_III. 1 hit.
    SUPFAMi SSF52833. SSF52833. 1 hit.
    PROSITEi PS01205. T4_DEIODINASE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and in vitro expression of the human selenoprotein, type I iodothyronine deiodinase."
      Mandel S.J., Berry M.J., Kieffer J.D., Harney J.W., Warne R.L., Larsen P.R.
      J. Clin. Endocrinol. Metab. 75:1133-1139(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Type I iodothyronine deiodinase splice variants in human liver."
      Wassen F.J.W.S., Kuiper G.G.J.M., Visser T.J.
      Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8 AND 9).
      Tissue: Liver.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
      Tissue: Kidney.
    5. "A novel retinoid X receptor-independent thyroid hormone response element is present in the human type 1 deiodinase gene."
      Toyoda N., Zavacki A.M., Maia A.L., Harney J.W., Larsen P.R.
      Mol. Cell. Biol. 15:5100-5112(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-25.

    Entry informationi

    Entry nameiIOD1_HUMAN
    AccessioniPrimary (citable) accession number: P49895
    Secondary accession number(s): Q1RN02
    , Q3KNP8, Q6Q4C1, Q6Q4C2, Q6Q4C3, Q6Q4C4, Q6Q4C5, Q6Q4C6, Q6Q4C7, Q6Q4C9, Q8WWC6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: February 26, 2008
    Last modified: October 1, 2014
    This is version 136 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3