Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Regulator of G-protein signaling 7

Gene

RGS7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:10521509, PubMed:10862767). The RGS7/GNB5 dimer enhances GNAO1 GTPase activity (PubMed:10521509). May play a role in synaptic vesicle exocytosis (PubMed:12659861). Modulates the activity of potassium channels that are activated by GNAO1 in response to muscarinic acetylcholine receptor M2/CHRM2 signaling (PubMed:15897264).1 Publication3 Publications

GO - Molecular functioni

  • G-protein beta-subunit binding Source: UniProtKB
  • GTPase activator activity Source: UniProtKB
  • signal transducer activity Source: InterPro

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation, Signal transduction inhibitor

Enzyme and pathway databases

BioCyciZFISH:G66-31181-MONOMER.
ReactomeiR-HSA-418594. G alpha (i) signalling events.
R-HSA-6814122. Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding.
SignaLinkiP49802.

Names & Taxonomyi

Protein namesi
Recommended name:
Regulator of G-protein signaling 7
Short name:
RGS7
Gene namesi
Name:RGS7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:10003. RGS7.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: UniProtKB
  • heterotrimeric G-protein complex Source: InterPro
  • plasma membrane Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi306W → F: Diminishes interaction with GNB5. 1 Publication1

Organism-specific databases

DisGeNETi6000.
OpenTargetsiENSG00000182901.
PharmGKBiPA34378.

Polymorphism and mutation databases

DMDMi17380284.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002041961 – 495Regulator of G-protein signaling 7Add BLAST495

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei229PhosphoserineBy similarity1
Modified residuei241PhosphoserineBy similarity1
Modified residuei243PhosphothreonineBy similarity1
Modified residuei434Phosphoserine1 Publication1

Post-translational modificationi

Palmitoylated.By similarity
Ubiquitinated, leading to rapid proteasomal degradation.1 Publication
Phosphorylation and subsequent interaction with 14-3-3 proteins inhibits GAP activity.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP49802.
PaxDbiP49802.
PeptideAtlasiP49802.
PRIDEiP49802.

PTM databases

iPTMnetiP49802.
PhosphoSitePlusiP49802.
SwissPalmiP49802.

Expressioni

Gene expression databases

BgeeiENSG00000182901.
CleanExiHS_RGS7.
ExpressionAtlasiP49802. baseline and differential.
GenevisibleiP49802. HS.

Organism-specific databases

HPAiCAB017561.
HPA000688.

Interactioni

Subunit structurei

Interacts with PKD1; this prevents rapid proteasomal degradation (PubMed:10339594). Interacts with GNB5 (PubMed:10521509, PubMed:10339615). Interacts with RGS7BP, leading to regulate the subcellular location of the heterodimer formed with GNB5 (PubMed:15897264). Interacts (phosphorylated form) with 14-3-3 protein YWHAQ (PubMed:10862767). Interacts with SNAPIN (PubMed:12659861). Interacts with GNAI1 (PubMed:18434541). Interacts with GNAO1, GNAI3 and GNAZ (By similarity).By similarity6 Publications

GO - Molecular functioni

  • G-protein beta-subunit binding Source: UniProtKB

Protein-protein interaction databases

BioGridi111932. 8 interactors.
DIPiDIP-40869N.
IntActiP49802. 5 interactors.
MINTiMINT-136910.
STRINGi9606.ENSP00000355523.

Chemistry databases

BindingDBiP49802.

Structurei

Secondary structure

1495
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi324 – 329Combined sources6
Helixi330 – 332Combined sources3
Helixi334 – 339Combined sources6
Helixi341 – 353Combined sources13
Helixi358 – 369Combined sources12
Helixi374 – 376Combined sources3
Helixi377 – 388Combined sources12
Helixi401 – 412Combined sources12
Turni414 – 419Combined sources6
Helixi420 – 432Combined sources13
Helixi434 – 440Combined sources7
Helixi442 – 449Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2A72X-ray2.00A/B320-463[»]
2D9JNMR-A323-448[»]
ProteinModelPortaliP49802.
SMRiP49802.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP49802.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini37 – 112DEPPROSITE-ProRule annotationAdd BLAST76
Domaini255 – 316G protein gammaAdd BLAST62
Domaini333 – 448RGSPROSITE-ProRule annotationAdd BLAST116

Sequence similaritiesi

Contains 1 DEP domain.PROSITE-ProRule annotation
Contains 1 G protein gamma domain.Curated
Contains 1 RGS domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3589. Eukaryota.
ENOG410YMJD. LUCA.
GeneTreeiENSGT00760000119142.
HOVERGENiHBG007404.
InParanoidiP49802.
KOiK16449.
OMAiDASCPIN.
OrthoDBiEOG091G05MO.
PhylomeDBiP49802.
TreeFamiTF351956.

Family and domain databases

CDDicd00068. GGL. 1 hit.
Gene3Di1.10.10.10. 1 hit.
1.10.196.10. 1 hit.
4.10.260.10. 1 hit.
InterProiIPR000591. DEP_dom.
IPR015898. G-protein_gamma-like_dom.
IPR016137. RGS.
IPR024066. RGS_subdom1.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00610. DEP. 1 hit.
PF00631. G-gamma. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSiPR01301. RGSPROTEIN.
SMARTiSM00049. DEP. 1 hit.
SM00224. GGL. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
SSF48097. SSF48097. 1 hit.
SSF48670. SSF48670. 1 hit.
PROSITEiPS50186. DEP. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P49802-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQGNNYGQT SNGVADESPN MLVYRKMEDV IARMQDEKNG IPIRTVKSFL
60 70 80 90 100
SKIPSVFSGS DIVQWLIKNL TIEDPVEALH LGTLMAAHGY FFPISDHVLT
110 120 130 140 150
LKDDGTFYRF QTPYFWPSNC WEPENTDYAV YLCKRTMQNK ARLELADYEA
160 170 180 190 200
ESLARLQRAF ARKWEFIFMQ AEAQAKVDKK RDKIERKILD SQERAFWDVH
210 220 230 240 250
RPVPGCVNTT EVDIKKSSRM RNPHKTRKSV YGLQNDIRSH SPTHTPTPET
260 270 280 290 300
KPPTEDELQQ QIKYWQIQLD RHRLKMSKVA DSLLSYTEQY LEYDPFLLPP
310 320 330 340 350
DPSNPWLSDD TTFWELEASK EPSQQRVKRW GFGMDEALKD PVGREQFLKF
360 370 380 390 400
LESEFSSENL RFWLAVEDLK KRPIKEVPSR VQEIWQEFLA PGAPSAINLD
410 420 430 440 450
SKSYDKTTQN VKEPGRYTFE DAQEHIYKLM KSDSYPRFIR SSAYQELLQA
460 470 480 490
KKKSGNSMDR RTSFEKFAQN VGRNIPIFPC HKNCTPTLRA STNLL
Length:495
Mass (Da):57,668
Last modified:October 18, 2001 - v3
Checksum:i1FCC2D60622675DE
GO
Isoform 2 (identifier: P49802-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     454-495: SGNSMDRRTSFEKFAQNVGRNIPIFPCHKNCTPTLRASTNLL → GKSLTSKRLTSLAQSY

Show »
Length:469
Mass (Da):54,685
Checksum:i993C1209EDD884EC
GO
Isoform 3 (identifier: P49802-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     454-471: Missing.

Show »
Length:477
Mass (Da):55,612
Checksum:iA7252A838E1881A9
GO
Isoform 4 (identifier: P49802-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-128: Missing.
     454-471: Missing.

Show »
Length:424
Mass (Da):49,387
Checksum:i25A8A2F507C07E87
GO
Isoform 5 (identifier: P49802-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     473-495: RNIPIFPCHKNCTPTLRASTNLL → KSLTSKRLTSLAQSY

Show »
Length:487
Mass (Da):56,741
Checksum:i50BDD0E8896444BC
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti26K → R in AAM12645 (Ref. 3) Curated1
Sequence conflicti234Q → R in AAM12644 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057153137M → L.Corresponds to variant rs12746550dbSNPEnsembl.1
Natural variantiVAR_060604409Q → H.1 PublicationCorresponds to variant rs17851953dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00567176 – 128Missing in isoform 4. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_005672454 – 495SGNSM…STNLL → GKSLTSKRLTSLAQSY in isoform 2. 2 PublicationsAdd BLAST42
Alternative sequenceiVSP_005673454 – 471Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_038388473 – 495RNIPI…STNLL → KSLTSKRLTSLAQSY in isoform 5. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF090116 mRNA. Translation: AAD34290.1.
AF090117 mRNA. Translation: AAD34291.1.
U32439 mRNA. Translation: AAC50351.1.
AF493930 mRNA. Translation: AAM12644.1.
AF493931 mRNA. Translation: AAM12645.1.
AY587875 mRNA. Translation: AAT52231.1.
AL512307
, AL359764, AL365184, AL590682 Genomic DNA. Translation: CAH71987.1.
AL512307
, AL359764, AL365184, AL590682 Genomic DNA. Translation: CAH71988.1.
AL512307
, AL359764, AL365184, AL590682 Genomic DNA. Translation: CAH71989.1.
AL512307
, AL359764, AL365184, AL590682 Genomic DNA. Translation: CAH71990.1.
AL590682
, AL359764, AL365184, AL512307 Genomic DNA. Translation: CAH73809.1.
AL590682
, AL359764, AL365184, AL512307 Genomic DNA. Translation: CAH73810.1.
AL590682
, AL359764, AL365184, AL512307 Genomic DNA. Translation: CAH73811.1.
AL590682
, AL359764, AL365184, AL512307 Genomic DNA. Translation: CAH73812.1.
AL359764
, AL365184, AL512307, AL590682 Genomic DNA. Translation: CAI15140.1.
AL359764
, AL365184, AL512307, AL590682 Genomic DNA. Translation: CAI15141.1.
AL359764
, AL365184, AL512307, AL590682 Genomic DNA. Translation: CAI15142.1.
AL359764
, AL365184, AL512307, AL590682 Genomic DNA. Translation: CAI15143.1.
AL365184
, AL359764, AL512307, AL590682 Genomic DNA. Translation: CAI16818.1.
AL365184
, AL359764, AL512307, AL590682 Genomic DNA. Translation: CAI16819.1.
AL365184
, AL359764, AL512307, AL590682 Genomic DNA. Translation: CAI16820.1.
AL365184
, AL359764, AL512307, AL590682 Genomic DNA. Translation: CAI16821.1.
CH471098 Genomic DNA. Translation: EAW70086.1.
BC022009 mRNA. Translation: AAH22009.1.
CCDSiCCDS31071.1. [P49802-5]
CCDS60457.1. [P49802-4]
CCDS60458.1. [P49802-2]
CCDS60459.1. [P49802-3]
RefSeqiNP_001269702.1. NM_001282773.1. [P49802-4]
NP_001269704.1. NM_001282775.1. [P49802-3]
NP_001269707.1. NM_001282778.1. [P49802-2]
NP_002915.3. NM_002924.5. [P49802-5]
XP_005273275.1. XM_005273218.3. [P49802-1]
UniGeneiHs.655739.

Genome annotation databases

EnsembliENST00000348120; ENSP00000341242; ENSG00000182901. [P49802-4]
ENST00000366563; ENSP00000355521; ENSG00000182901. [P49802-3]
ENST00000366564; ENSP00000355522; ENSG00000182901. [P49802-2]
ENST00000366565; ENSP00000355523; ENSG00000182901. [P49802-5]
GeneIDi6000.
KEGGihsa:6000.
UCSCiuc001hyu.4. human. [P49802-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF090116 mRNA. Translation: AAD34290.1.
AF090117 mRNA. Translation: AAD34291.1.
U32439 mRNA. Translation: AAC50351.1.
AF493930 mRNA. Translation: AAM12644.1.
AF493931 mRNA. Translation: AAM12645.1.
AY587875 mRNA. Translation: AAT52231.1.
AL512307
, AL359764, AL365184, AL590682 Genomic DNA. Translation: CAH71987.1.
AL512307
, AL359764, AL365184, AL590682 Genomic DNA. Translation: CAH71988.1.
AL512307
, AL359764, AL365184, AL590682 Genomic DNA. Translation: CAH71989.1.
AL512307
, AL359764, AL365184, AL590682 Genomic DNA. Translation: CAH71990.1.
AL590682
, AL359764, AL365184, AL512307 Genomic DNA. Translation: CAH73809.1.
AL590682
, AL359764, AL365184, AL512307 Genomic DNA. Translation: CAH73810.1.
AL590682
, AL359764, AL365184, AL512307 Genomic DNA. Translation: CAH73811.1.
AL590682
, AL359764, AL365184, AL512307 Genomic DNA. Translation: CAH73812.1.
AL359764
, AL365184, AL512307, AL590682 Genomic DNA. Translation: CAI15140.1.
AL359764
, AL365184, AL512307, AL590682 Genomic DNA. Translation: CAI15141.1.
AL359764
, AL365184, AL512307, AL590682 Genomic DNA. Translation: CAI15142.1.
AL359764
, AL365184, AL512307, AL590682 Genomic DNA. Translation: CAI15143.1.
AL365184
, AL359764, AL512307, AL590682 Genomic DNA. Translation: CAI16818.1.
AL365184
, AL359764, AL512307, AL590682 Genomic DNA. Translation: CAI16819.1.
AL365184
, AL359764, AL512307, AL590682 Genomic DNA. Translation: CAI16820.1.
AL365184
, AL359764, AL512307, AL590682 Genomic DNA. Translation: CAI16821.1.
CH471098 Genomic DNA. Translation: EAW70086.1.
BC022009 mRNA. Translation: AAH22009.1.
CCDSiCCDS31071.1. [P49802-5]
CCDS60457.1. [P49802-4]
CCDS60458.1. [P49802-2]
CCDS60459.1. [P49802-3]
RefSeqiNP_001269702.1. NM_001282773.1. [P49802-4]
NP_001269704.1. NM_001282775.1. [P49802-3]
NP_001269707.1. NM_001282778.1. [P49802-2]
NP_002915.3. NM_002924.5. [P49802-5]
XP_005273275.1. XM_005273218.3. [P49802-1]
UniGeneiHs.655739.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2A72X-ray2.00A/B320-463[»]
2D9JNMR-A323-448[»]
ProteinModelPortaliP49802.
SMRiP49802.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111932. 8 interactors.
DIPiDIP-40869N.
IntActiP49802. 5 interactors.
MINTiMINT-136910.
STRINGi9606.ENSP00000355523.

Chemistry databases

BindingDBiP49802.

PTM databases

iPTMnetiP49802.
PhosphoSitePlusiP49802.
SwissPalmiP49802.

Polymorphism and mutation databases

DMDMi17380284.

Proteomic databases

MaxQBiP49802.
PaxDbiP49802.
PeptideAtlasiP49802.
PRIDEiP49802.

Protocols and materials databases

DNASUi6000.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000348120; ENSP00000341242; ENSG00000182901. [P49802-4]
ENST00000366563; ENSP00000355521; ENSG00000182901. [P49802-3]
ENST00000366564; ENSP00000355522; ENSG00000182901. [P49802-2]
ENST00000366565; ENSP00000355523; ENSG00000182901. [P49802-5]
GeneIDi6000.
KEGGihsa:6000.
UCSCiuc001hyu.4. human. [P49802-1]

Organism-specific databases

CTDi6000.
DisGeNETi6000.
GeneCardsiRGS7.
HGNCiHGNC:10003. RGS7.
HPAiCAB017561.
HPA000688.
MIMi602517. gene.
neXtProtiNX_P49802.
OpenTargetsiENSG00000182901.
PharmGKBiPA34378.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3589. Eukaryota.
ENOG410YMJD. LUCA.
GeneTreeiENSGT00760000119142.
HOVERGENiHBG007404.
InParanoidiP49802.
KOiK16449.
OMAiDASCPIN.
OrthoDBiEOG091G05MO.
PhylomeDBiP49802.
TreeFamiTF351956.

Enzyme and pathway databases

BioCyciZFISH:G66-31181-MONOMER.
ReactomeiR-HSA-418594. G alpha (i) signalling events.
R-HSA-6814122. Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding.
SignaLinkiP49802.

Miscellaneous databases

ChiTaRSiRGS7. human.
EvolutionaryTraceiP49802.
GeneWikiiRGS7.
GenomeRNAii6000.
PROiP49802.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000182901.
CleanExiHS_RGS7.
ExpressionAtlasiP49802. baseline and differential.
GenevisibleiP49802. HS.

Family and domain databases

CDDicd00068. GGL. 1 hit.
Gene3Di1.10.10.10. 1 hit.
1.10.196.10. 1 hit.
4.10.260.10. 1 hit.
InterProiIPR000591. DEP_dom.
IPR015898. G-protein_gamma-like_dom.
IPR016137. RGS.
IPR024066. RGS_subdom1.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00610. DEP. 1 hit.
PF00631. G-gamma. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSiPR01301. RGSPROTEIN.
SMARTiSM00049. DEP. 1 hit.
SM00224. GGL. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
SSF48097. SSF48097. 1 hit.
SSF48670. SSF48670. 1 hit.
PROSITEiPS50186. DEP. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRGS7_HUMAN
AccessioniPrimary (citable) accession number: P49802
Secondary accession number(s): Q5T3H4
, Q8TD66, Q8TD67, Q8WW09, Q9UNU7, Q9Y6B9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 18, 2001
Last modified: November 2, 2016
This is version 167 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.