P49802 (RGS7_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 135.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Regulator of G-protein signaling 7 Short name=RGS7 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 495 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/GNG5 dimer. May play a role in synaptic vesicle exocytosis. May play important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations By similarity. |
| Subunit structure | Heterodimer with GNG5. Interacts with RGS7BP, leading to regulate the subcellular location of the heterodimer formed with Gbeta5 By similarity. Interacts with 14-3-3 protein Tau and SNAPIN. Ref.7 Ref.8 Ref.9 |
| Post-translational modification | Palmitoylated By similarity. Phosphorylation and subsequent interaction with 14-3-3 proteins inhibits GAP activity. |
| Sequence similarities | Contains 1 DEP domain. Contains 1 G protein gamma domain. Contains 1 RGS domain. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P49802-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P49802-2) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 454-495: SGNSMDRRTSFEKFAQNVGRNIPIFPCHKNCTPTLRASTNLL → GKSLTSKRLTSLAQSY | ||||||
| Isoform 3 (identifier: P49802-3) The sequence of this isoform differs from the canonical sequence as follows: 454-471: Missing. | ||||||
| Isoform 4 (identifier: P49802-4) The sequence of this isoform differs from the canonical sequence as follows: 76-128: Missing. 454-471: Missing. | ||||||
| Isoform 5 (identifier: P49802-5) The sequence of this isoform differs from the canonical sequence as follows: 473-495: RNIPIFPCHKNCTPTLRASTNLL → KSLTSKRLTSLAQSY |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 495 | 495 | Regulator of G-protein signaling 7 | PRO_0000204196 | ||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||
| Domain | 37 – 112 | 76 | DEP | |||||||||||||||||||||||||||
| Domain | 255 – 316 | 62 | G protein gamma | |||||||||||||||||||||||||||
| Domain | 333 – 448 | 116 | RGS | |||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||
| Modified residue | 229 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||
| Modified residue | 434 | 1 | Phosphoserine | |||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 76 – 128 | 53 | Missing in isoform 4. | VSP_005671 | ||||||||||||||||||||||||||
| Alternative sequence | 454 – 495 | 42 | SGNSM…STNLL → GKSLTSKRLTSLAQSY in isoform 2. | VSP_005672 | ||||||||||||||||||||||||||
| Alternative sequence | 454 – 471 | 18 | Missing in isoform 3 and isoform 4. | VSP_005673 | ||||||||||||||||||||||||||
| Alternative sequence | 473 – 495 | 23 | RNIPI…STNLL → KSLTSKRLTSLAQSY in isoform 5. | VSP_038388 | ||||||||||||||||||||||||||
| Natural variant | 137 | 1 | M → L. Corresponds to variant rs12746550 [ dbSNP | Ensembl ]. | VAR_057153 | ||||||||||||||||||||||||||
| Natural variant | 409 | 1 | Q → H. Ref.6 Corresponds to variant rs17851953 [ dbSNP | Ensembl ]. | VAR_060604 | ||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||
| Mutagenesis | 306 | 1 | W → F: Diminishes interaction with Gbeta5. Ref.7 | |||||||||||||||||||||||||||
| Sequence conflict | 26 | 1 | K → R in AAM12645. Ref.3 | |||||||||||||||||||||||||||
| Sequence conflict | 234 | 1 | Q → R in AAM12644. Ref.3 | |||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Helix | 324 – 329 | 6 | ||||||||||||||||||||||||||||
| Helix | 330 – 332 | 3 | ||||||||||||||||||||||||||||
| Helix | 334 – 339 | 6 | ||||||||||||||||||||||||||||
| Helix | 341 – 353 | 13 | ||||||||||||||||||||||||||||
| Helix | 358 – 369 | 12 | ||||||||||||||||||||||||||||
| Helix | 374 – 376 | 3 | ||||||||||||||||||||||||||||
| Helix | 377 – 388 | 12 | ||||||||||||||||||||||||||||
| Helix | 401 – 412 | 12 | ||||||||||||||||||||||||||||
| Turn | 414 – 419 | 6 | ||||||||||||||||||||||||||||
| Helix | 420 – 432 | 13 | ||||||||||||||||||||||||||||
| Helix | 434 – 440 | 7 | ||||||||||||||||||||||||||||
| Helix | 442 – 449 | 8 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Interaction between RGS7 and polycystin." Kim E., Arnould T., Sellin L., Benzing T., Comella N., Kocher O., Tsiokas L., Sukhatme V.P., Walz G. Proc. Natl. Acad. Sci. U.S.A. 96:6371-6376(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [2] | "EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins." Koelle M.R., Horvitz H.R. Cell 84:115-125(1996) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Puhl H.L. III, Ikeda S.R., Aronstam R.S. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4). Tissue: Brain. |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), VARIANT HIS-409. Tissue: Testis. |
| [7] | "Fidelity of G protein beta-subunit association by the G protein gamma-subunit-like domains of RGS6, RGS7, and RGS11." Snow B.E., Betts L., Mangion J., Sondek J., Siderovski D.P. Proc. Natl. Acad. Sci. U.S.A. 96:6489-6494(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GBETA5, MUTAGENESIS OF TRP-306. Tissue: Brain. |
| [8] | "14-3-3 interacts with regulator of G protein signaling proteins and modulates their activity." Benzing T., Yaffe M.B., Arnould T., Sellin L., Schermer B., Schilling B., Schreiber R., Kunzelmann K., Leparc G.G., Kim E., Walz G. J. Biol. Chem. 275:28167-28172(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION, INTERACTION WITH 14-3-3 PROTEINS. |
| [9] | "Snapin interacts with the N-terminus of regulator of G protein signaling 7." Hunt R.A., Edris W., Chanda P.K., Nieuwenhuijsen B., Young K.H. Biochem. Biophys. Res. Commun. 303:594-599(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SNAPIN. |
| [10] | "Solution structure of the RGS domain of regulator of G-protein signaling 7." RIKEN structural genomics initiative (RSGI) Submitted (DEC-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 323-448. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF090116 mRNA. Translation: AAD34290.1. AF090117 mRNA. Translation: AAD34291.1. U32439 mRNA. Translation: AAC50351.1. AF493930 mRNA. Translation: AAM12644.1. AF493931 mRNA. Translation: AAM12645.1. AY587875 mRNA. Translation: AAT52231.1. AL512307 AL590682 Genomic DNA. Translation: CAH71987.1.AL512307 AL590682 Genomic DNA. Translation: CAH71988.1.AL512307 AL590682 Genomic DNA. Translation: CAH71989.1.AL512307 AL590682 Genomic DNA. Translation: CAH71990.1.AL590682 AL512307 Genomic DNA. Translation: CAH73809.1.AL590682 AL512307 Genomic DNA. Translation: CAH73810.1.AL590682 AL512307 Genomic DNA. Translation: CAH73811.1.AL590682 AL512307 Genomic DNA. Translation: CAH73812.1.AL359764 AL590682 Genomic DNA. Translation: CAI15140.1.AL359764 AL590682 Genomic DNA. Translation: CAI15141.1.AL359764 AL590682 Genomic DNA. Translation: CAI15142.1.AL359764 AL590682 Genomic DNA. Translation: CAI15143.1.AL365184 AL590682 Genomic DNA. Translation: CAI16818.1.AL365184 AL590682 Genomic DNA. Translation: CAI16819.1.AL365184 AL590682 Genomic DNA. Translation: CAI16820.1.AL365184 AL590682 Genomic DNA. Translation: CAI16821.1.CH471098 Genomic DNA. Translation: EAW70086.1. BC022009 mRNA. Translation: AAH22009.1. | ||||||||||||||||||
| IPI | IPI00028457. IPI00220660. IPI00220661. IPI00257291. IPI00874132. | ||||||||||||||||||
| RefSeq | NP_002915.3. NM_002924.4. | ||||||||||||||||||
| UniGene | Hs.655739. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P49802. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-40869N. | ||||||||||||||||||
| IntAct | P49802. 4 interactions. | ||||||||||||||||||
| MINT | MINT-136910. | ||||||||||||||||||
| STRING | 9606.ENSP00000355520. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P49802. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 17380284. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P49802. | ||||||||||||||||||
| PRIDE | P49802. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 6000. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000348120; ENSP00000341242; ENSG00000182901. ENST00000366562; ENSP00000355520; ENSG00000182901. ENST00000366563; ENSP00000355521; ENSG00000182901. ENST00000366564; ENSP00000355522; ENSG00000182901. ENST00000366565; ENSP00000355523; ENSG00000182901. ENST00000401882; ENSP00000385508; ENSG00000182901. ENST00000407727; ENSP00000384428; ENSG00000182901. | ||||||||||||||||||
| GeneID | 6000. | ||||||||||||||||||
| KEGG | hsa:6000. | ||||||||||||||||||
| UCSC | uc001hyt.2. human. uc001hyu.2. human. uc001hyv.2. human. uc001hyw.2. human. uc009xgn.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 6000. | ||||||||||||||||||
| GeneCards | GC01M240938. | ||||||||||||||||||
| HGNC | HGNC:10003. RGS7. | ||||||||||||||||||
| HPA | CAB017561. HPA000688. | ||||||||||||||||||
| MIM | 602517. gene. | ||||||||||||||||||
| neXtProt | NX_P49802. | ||||||||||||||||||
| PharmGKB | PA34378. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG327614. | ||||||||||||||||||
| HOVERGEN | HBG007404. | ||||||||||||||||||
| InParanoid | P49802. | ||||||||||||||||||
| KO | K16449. | ||||||||||||||||||
| OMA | AHVYHLM. | ||||||||||||||||||
| PhylomeDB | P49802. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P49802. | ||||||||||||||||||
| Bgee | P49802. | ||||||||||||||||||
| CleanEx | HS_RGS7. | ||||||||||||||||||
| Genevestigator | P49802. | ||||||||||||||||||
| GermOnline | ENSG00000182901. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.10.10.10. 1 hit. 1.10.196.10. 1 hit. 4.10.260.10. 1 hit. | ||||||||||||||||||
| InterPro | IPR000591. DEP_dom. IPR015898. G-protein_gamma-like_dom. IPR000342. Regulat_G_prot_signal. IPR024066. Regulat_G_prot_signal_dom1. IPR016137. Regulat_G_prot_signal_superfam. IPR011991. WHTH_DNA-bd_dom. [Graphical view] | ||||||||||||||||||
| Pfam | PF00610. DEP. 1 hit. PF00631. G-gamma. 1 hit. PF00615. RGS. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR01301. RGSPROTEIN. | ||||||||||||||||||
| SMART | SM00049. DEP. 1 hit. SM00224. GGL. 1 hit. SM00315. RGS. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF48670. G-protein_gamma-like. 1 hit. SSF48097. Regulat_G_prot_signal_superfam. 1 hit. | ||||||||||||||||||
| PROSITE | PS50186. DEP. 1 hit. PS50058. G_PROTEIN_GAMMA. False negative. PS50132. RGS. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | RGS7. human. | ||||||||||||||||||
| EvolutionaryTrace | P49802. | ||||||||||||||||||
| GenomeRNAi | 6000. | ||||||||||||||||||
| NextBio | 23395. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | RGS7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P49802 Secondary accession number(s): Q5T3H4 Q9Y6B9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
