SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P49797

- RGS3_RAT

UniProt

P49797 - RGS3_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Regulator of G-protein signaling 3

Gene
Rgs3
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.

GO - Molecular functioni

  1. GTPase activator activity Source: RefGenome

GO - Biological processi

  1. positive regulation of GTPase activity Source: GOC
  2. signal transduction Source: RGD
  3. termination of G-protein coupled receptor signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Signal transduction inhibitor

Names & Taxonomyi

Protein namesi
Recommended name:
Regulator of G-protein signaling 3
Short name:
RGS3
Alternative name(s):
SRB-RGS
Gene namesi
Name:Rgs3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 5

Organism-specific databases

RGDi3566. Rgs3.

Subcellular locationi

Cytoplasm By similarity. Membrane; Peripheral membrane protein By similarity. Nucleus By similarity

GO - Cellular componenti

  1. cytoplasm Source: RefGenome
  2. nucleus Source: UniProtKB-SubCell
  3. plasma membrane Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 967967Regulator of G-protein signaling 3PRO_0000204184Add
BLAST

Post-translational modificationi

Phosphorylated by cyclic GMP-dependent protein kinase.1 Publication
ISGylated By similarity.

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP49797.
PRIDEiP49797.

Expressioni

Tissue specificityi

Detected in kidney, uterus, ovary, heart, brain, spleen, lung and testis.2 Publications

Gene expression databases

GenevestigatoriP49797.

Interactioni

Subunit structurei

Binds EFNB1 and EFNB2. Binds the GNB1-GNG2 heterodimer By similarity. Binds ESR1.

Protein-protein interaction databases

BioGridi248513. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliP49797.
SMRiP49797. Positions 15-95, 833-959.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini18 – 9578PDZAdd
BLAST
Domaini842 – 967126RGSAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi424 – 592169Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.
Contains 1 RGS domain.

Phylogenomic databases

eggNOGiNOG266213.
GeneTreeiENSGT00750000117382.
HOGENOMiHOG000154114.
HOVERGENiHBG013233.
InParanoidiP49797.
KOiK07524.
OMAiTYDLQSP.
OrthoDBiEOG7VHSZ5.
PhylomeDBiP49797.

Family and domain databases

Gene3Di1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
IPR011993. PH_like_dom.
IPR024066. Regulat_G_prot_signal_dom1.
IPR016137. Regulat_G_prot_signal_superfam.
IPR000342. RGS_dom.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSiPR01301. RGSPROTEIN.
SMARTiSM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF48097. SSF48097. 1 hit.
SSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P49797-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNRFNGLCKV CSERRYRQIT IRRGKDGFGF TICCDSPVRV QAVDSGGPAE    50
RAGLQQLDTV LQLNERPVEH WKCVELAHEI RSCPSEIILL VWRVVPQIKP 100
GPDGGVLRRA SCKSTHDLLS PPNKREKNCT HGAPTRPEQR HSCHLVCDSS 150
DGLLLGGWER YTEVGKRSGQ HTLPALSRAT TPTDPNYIIL APLNPGSQLL 200
RPVYQEDAIP EEPGTTTKGK SYTGLGKKSR LMKTVQTMKG HSNYQDCSAL 250
RPHIPHSSYG TYVTLAPKVL VFPVFVQPLD LCNPARTLLL SEELLLYEGR 300
NKTSQVTLFA YSDLLLFTKE EEPGRCDVLR NPLYLQSVKL QEGSSEDLKF 350
CVLYLAEKAE CLFTLEAHSQ EQKKRVCWCL SENIAKQQQL AATPTERKMF 400
ETEADEKEMP LVEGKGPGAE ERTPSKDPSP SQELPPGQEL PPSKDPSPSQ 450
ELPPGQELPP SKDPSPSQEL PPGQELPSSK NPSPSQELPA GQDLPPRKES 500
FSGQEAAPGP ESPSSEDIAT CQNPPQSPET STSKDSPPGQ GSSPTTEVPS 550
CQGLPAGQES TSQDPLLSQE PPAIPESSAS DQNVLPSQES PPSQGSLSEK 600
ALAEQTISPG ELPAATAGEP SASRPNFVIP EVRLDSAYSQ QDGAHGGSSG 650
EDEDAEEGEE GEEGEEDEED DTNDDNYGDR NEAKRSSLIE TGQGAEGGLS 700
LRVQNSLRRR THSEGSLLQE ARGPCFASDT TLHCSDGEGT TSTWAIPSPR 750
TLKKELGRNG GSMHHLSLFF TGHRKMSGTD LADDVEASRK RKSKNIAKDM 800
KNKLAIFRRR NESPGAQPAG KADKTTKSFK PTSEEALKWS ESLEKLLLHK 850
YGLEVFQAFL RTEFSEENLE FWLACEDFKK VKSQSKMAAK AKKIFAEFIA 900
IQACKEVNLD SYTREHTKEN LQSITRGCFD LAQKRIFGLM EKDSYPRFLR 950
SDLYLDLINQ KKMSPPL 967
Length:967
Mass (Da):106,380
Last modified:June 7, 2005 - v2
Checksum:i5C558885DBA63A5B
GO
Isoform 2 (identifier: P49797-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     399-433: MFETEADEKEMPLVEGKGPGAEERTPSKDPSPSQE → KLHPYGSLQQEMGPVTSINATQDRSFTSSGQTLIG
     434-967: Missing.

Note: No experimental confirmation available.

Show »
Length:433
Mass (Da):48,356
Checksum:iCFAFB8C48FF97977
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei399 – 43335MFETE…SPSQE → KLHPYGSLQQEMGPVTSINA TQDRSFTSSGQTLIG in isoform 2. VSP_013971Add
BLAST
Alternative sequencei434 – 967534Missing in isoform 2. VSP_013972Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB055153 mRNA. Translation: BAB63460.1.
BC085710 mRNA. Translation: AAH85710.1.
U32434 mRNA. Translation: AAC52371.1.
RefSeqiNP_062213.1. NM_019340.1. [P49797-1]
XP_006238327.1. XM_006238265.1. [P49797-2]
UniGeneiRn.53900.

Genome annotation databases

EnsembliENSRNOT00000059181; ENSRNOP00000055954; ENSRNOG00000045849. [P49797-2]
GeneIDi54293.
KEGGirno:54293.
UCSCiRGD:3566. rat. [P49797-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB055153 mRNA. Translation: BAB63460.1 .
BC085710 mRNA. Translation: AAH85710.1 .
U32434 mRNA. Translation: AAC52371.1 .
RefSeqi NP_062213.1. NM_019340.1. [P49797-1 ]
XP_006238327.1. XM_006238265.1. [P49797-2 ]
UniGenei Rn.53900.

3D structure databases

ProteinModelPortali P49797.
SMRi P49797. Positions 15-95, 833-959.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 248513. 1 interaction.

Proteomic databases

PaxDbi P49797.
PRIDEi P49797.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000059181 ; ENSRNOP00000055954 ; ENSRNOG00000045849 . [P49797-2 ]
GeneIDi 54293.
KEGGi rno:54293.
UCSCi RGD:3566. rat. [P49797-1 ]

Organism-specific databases

CTDi 5998.
RGDi 3566. Rgs3.

Phylogenomic databases

eggNOGi NOG266213.
GeneTreei ENSGT00750000117382.
HOGENOMi HOG000154114.
HOVERGENi HBG013233.
InParanoidi P49797.
KOi K07524.
OMAi TYDLQSP.
OrthoDBi EOG7VHSZ5.
PhylomeDBi P49797.

Miscellaneous databases

NextBioi 610908.
PROi P49797.

Gene expression databases

Genevestigatori P49797.

Family and domain databases

Gene3Di 1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
InterProi IPR001478. PDZ.
IPR011993. PH_like_dom.
IPR024066. Regulat_G_prot_signal_dom1.
IPR016137. Regulat_G_prot_signal_superfam.
IPR000342. RGS_dom.
[Graphical view ]
Pfami PF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view ]
PRINTSi PR01301. RGSPROTEIN.
SMARTi SM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view ]
SUPFAMi SSF48097. SSF48097. 1 hit.
SSF50156. SSF50156. 1 hit.
PROSITEi PS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of a steroid receptor-binding regulator of G-protein signaling protein cDNA."
    Ikeda M., Hirokawa M., Satani N., Kinoshita T., Watanabe Y., Inoue H., Tone S., Ishikawa T., Minatogawa Y.
    Gene 273:207-214(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH ESR1, TISSUE SPECIFICITY.
    Tissue: Ovary.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Heart.
  3. "EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins."
    Koelle M.R., Horvitz H.R.
    Cell 84:115-125(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 873-939 (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Brain.
  4. "Natriuretic peptides inhibit G protein activation. Mediation through cross-talk between cyclic GMP-dependent protein kinase and regulators of G protein-signaling proteins."
    Pedram A., Razandi M., Kehrl J., Levin E.R.
    J. Biol. Chem. 275:7365-7372(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION.

Entry informationi

Entry nameiRGS3_RAT
AccessioniPrimary (citable) accession number: P49797
Secondary accession number(s): Q5RKK6, Q920Q9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: June 7, 2005
Last modified: May 14, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi