Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P49797 (RGS3_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 104. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Regulator of G-protein signaling 3

Short name=RGS3
Alternative name(s):
SRB-RGS
Gene names
Name:Rgs3
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length967 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.

Subunit structure

Binds EFNB1 and EFNB2. Binds the GNB1-GNG2 heterodimer By similarity. Binds ESR1.

Subcellular location

Cytoplasm By similarity. Membrane; Peripheral membrane protein By similarity. Nucleus By similarity.

Tissue specificity

Detected in kidney, uterus, ovary, heart, brain, spleen, lung and testis. Ref.1 Ref.3

Post-translational modification

Phosphorylated by cyclic GMP-dependent protein kinase. Ref.4

ISGylated By similarity.

Sequence similarities

Contains 1 PDZ (DHR) domain.

Contains 1 RGS domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P49797-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P49797-2)

The sequence of this isoform differs from the canonical sequence as follows:
     399-433: MFETEADEKEMPLVEGKGPGAEERTPSKDPSPSQE → KLHPYGSLQQEMGPVTSINATQDRSFTSSGQTLIG
     434-967: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 967967Regulator of G-protein signaling 3
PRO_0000204184

Regions

Domain18 – 9578PDZ
Domain842 – 967126RGS
Compositional bias424 – 592169Pro-rich

Natural variations

Alternative sequence399 – 43335MFETE…SPSQE → KLHPYGSLQQEMGPVTSINA TQDRSFTSSGQTLIG in isoform 2.
VSP_013971
Alternative sequence434 – 967534Missing in isoform 2.
VSP_013972

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 7, 2005. Version 2.
Checksum: 5C558885DBA63A5B

FASTA967106,380
        10         20         30         40         50         60 
MNRFNGLCKV CSERRYRQIT IRRGKDGFGF TICCDSPVRV QAVDSGGPAE RAGLQQLDTV 

        70         80         90        100        110        120 
LQLNERPVEH WKCVELAHEI RSCPSEIILL VWRVVPQIKP GPDGGVLRRA SCKSTHDLLS 

       130        140        150        160        170        180 
PPNKREKNCT HGAPTRPEQR HSCHLVCDSS DGLLLGGWER YTEVGKRSGQ HTLPALSRAT 

       190        200        210        220        230        240 
TPTDPNYIIL APLNPGSQLL RPVYQEDAIP EEPGTTTKGK SYTGLGKKSR LMKTVQTMKG 

       250        260        270        280        290        300 
HSNYQDCSAL RPHIPHSSYG TYVTLAPKVL VFPVFVQPLD LCNPARTLLL SEELLLYEGR 

       310        320        330        340        350        360 
NKTSQVTLFA YSDLLLFTKE EEPGRCDVLR NPLYLQSVKL QEGSSEDLKF CVLYLAEKAE 

       370        380        390        400        410        420 
CLFTLEAHSQ EQKKRVCWCL SENIAKQQQL AATPTERKMF ETEADEKEMP LVEGKGPGAE 

       430        440        450        460        470        480 
ERTPSKDPSP SQELPPGQEL PPSKDPSPSQ ELPPGQELPP SKDPSPSQEL PPGQELPSSK 

       490        500        510        520        530        540 
NPSPSQELPA GQDLPPRKES FSGQEAAPGP ESPSSEDIAT CQNPPQSPET STSKDSPPGQ 

       550        560        570        580        590        600 
GSSPTTEVPS CQGLPAGQES TSQDPLLSQE PPAIPESSAS DQNVLPSQES PPSQGSLSEK 

       610        620        630        640        650        660 
ALAEQTISPG ELPAATAGEP SASRPNFVIP EVRLDSAYSQ QDGAHGGSSG EDEDAEEGEE 

       670        680        690        700        710        720 
GEEGEEDEED DTNDDNYGDR NEAKRSSLIE TGQGAEGGLS LRVQNSLRRR THSEGSLLQE 

       730        740        750        760        770        780 
ARGPCFASDT TLHCSDGEGT TSTWAIPSPR TLKKELGRNG GSMHHLSLFF TGHRKMSGTD 

       790        800        810        820        830        840 
LADDVEASRK RKSKNIAKDM KNKLAIFRRR NESPGAQPAG KADKTTKSFK PTSEEALKWS 

       850        860        870        880        890        900 
ESLEKLLLHK YGLEVFQAFL RTEFSEENLE FWLACEDFKK VKSQSKMAAK AKKIFAEFIA 

       910        920        930        940        950        960 
IQACKEVNLD SYTREHTKEN LQSITRGCFD LAQKRIFGLM EKDSYPRFLR SDLYLDLINQ 


KKMSPPL 

« Hide

Isoform 2 [UniParc].

Checksum: CFAFB8C48FF97977
Show »

FASTA43348,356

References

« Hide 'large scale' references
[1]"Molecular cloning and characterization of a steroid receptor-binding regulator of G-protein signaling protein cDNA."
Ikeda M., Hirokawa M., Satani N., Kinoshita T., Watanabe Y., Inoue H., Tone S., Ishikawa T., Minatogawa Y.
Gene 273:207-214(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH ESR1, TISSUE SPECIFICITY.
Tissue: Ovary.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Heart.
[3]"EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins."
Koelle M.R., Horvitz H.R.
Cell 84:115-125(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 873-939 (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Brain.
[4]"Natriuretic peptides inhibit G protein activation. Mediation through cross-talk between cyclic GMP-dependent protein kinase and regulators of G protein-signaling proteins."
Pedram A., Razandi M., Kehrl J., Levin E.R.
J. Biol. Chem. 275:7365-7372(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB055153 mRNA. Translation: BAB63460.1.
BC085710 mRNA. Translation: AAH85710.1.
U32434 mRNA. Translation: AAC52371.1.
RefSeqNP_062213.1. NM_019340.1. [P49797-1]
XP_006238327.1. XM_006238265.1. [P49797-2]
UniGeneRn.53900.

3D structure databases

ProteinModelPortalP49797.
SMRP49797. Positions 15-95, 833-959.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid248513. 1 interaction.

Proteomic databases

PaxDbP49797.
PRIDEP49797.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000059181; ENSRNOP00000055954; ENSRNOG00000045849. [P49797-2]
GeneID54293.
KEGGrno:54293.
UCSCRGD:3566. rat. [P49797-1]

Organism-specific databases

CTD5998.
RGD3566. Rgs3.

Phylogenomic databases

eggNOGNOG266213.
GeneTreeENSGT00750000117382.
HOGENOMHOG000154114.
HOVERGENHBG013233.
InParanoidP49797.
KOK07524.
OMATYDLQSP.
OrthoDBEOG7VHSZ5.
PhylomeDBP49797.

Gene expression databases

GenevestigatorP49797.

Family and domain databases

Gene3D1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
InterProIPR001478. PDZ.
IPR011993. PH_like_dom.
IPR024066. Regulat_G_prot_signal_dom1.
IPR016137. Regulat_G_prot_signal_superfam.
IPR000342. RGS_dom.
[Graphical view]
PfamPF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSPR01301. RGSPROTEIN.
SMARTSM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMSSF48097. SSF48097. 1 hit.
SSF50156. SSF50156. 1 hit.
PROSITEPS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio610908.
PROP49797.

Entry information

Entry nameRGS3_RAT
AccessionPrimary (citable) accession number: P49797
Secondary accession number(s): Q5RKK6, Q920Q9
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: June 7, 2005
Last modified: May 14, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families