Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P49797

- RGS3_RAT

UniProt

P49797 - RGS3_RAT

Protein

Regulator of G-protein signaling 3

Gene

Rgs3

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 2 (07 Jun 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.

    GO - Molecular functioni

    1. GTPase activator activity Source: RefGenome

    GO - Biological processi

    1. positive regulation of GTPase activity Source: GOC
    2. signal transduction Source: RGD
    3. termination of G-protein coupled receptor signaling pathway Source: InterPro

    Keywords - Molecular functioni

    Signal transduction inhibitor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Regulator of G-protein signaling 3
    Short name:
    RGS3
    Alternative name(s):
    SRB-RGS
    Gene namesi
    Name:Rgs3
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Chromosome 5

    Organism-specific databases

    RGDi3566. Rgs3.

    Subcellular locationi

    Cytoplasm By similarity. Membrane By similarity; Peripheral membrane protein By similarity. Nucleus By similarity

    GO - Cellular componenti

    1. cytoplasm Source: RefGenome
    2. nucleus Source: UniProtKB-SubCell
    3. plasma membrane Source: RefGenome

    Keywords - Cellular componenti

    Cytoplasm, Membrane, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 967967Regulator of G-protein signaling 3PRO_0000204184Add
    BLAST

    Post-translational modificationi

    Phosphorylated by cyclic GMP-dependent protein kinase.1 Publication
    ISGylated.By similarity

    Keywords - PTMi

    Phosphoprotein, Ubl conjugation

    Proteomic databases

    PaxDbiP49797.
    PRIDEiP49797.

    Expressioni

    Tissue specificityi

    Detected in kidney, uterus, ovary, heart, brain, spleen, lung and testis.2 Publications

    Gene expression databases

    GenevestigatoriP49797.

    Interactioni

    Subunit structurei

    Binds EFNB1 and EFNB2. Binds the GNB1-GNG2 heterodimer By similarity. Binds ESR1.By similarity

    Protein-protein interaction databases

    BioGridi248513. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliP49797.
    SMRiP49797. Positions 15-95, 833-959.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini18 – 9578PDZPROSITE-ProRule annotationAdd
    BLAST
    Domaini842 – 967126RGSPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi424 – 592169Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
    Contains 1 RGS domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG266213.
    GeneTreeiENSGT00750000117382.
    HOGENOMiHOG000154114.
    HOVERGENiHBG013233.
    InParanoidiP49797.
    KOiK07524.
    OMAiTYDLQSP.
    OrthoDBiEOG7VHSZ5.
    PhylomeDBiP49797.

    Family and domain databases

    Gene3Di1.10.196.10. 2 hits.
    2.30.29.30. 1 hit.
    2.30.42.10. 1 hit.
    InterProiIPR001478. PDZ.
    IPR011993. PH_like_dom.
    IPR024066. Regulat_G_prot_signal_dom1.
    IPR016137. Regulat_G_prot_signal_superfam.
    IPR000342. RGS_dom.
    [Graphical view]
    PfamiPF00595. PDZ. 1 hit.
    PF00615. RGS. 1 hit.
    [Graphical view]
    PRINTSiPR01301. RGSPROTEIN.
    SMARTiSM00228. PDZ. 1 hit.
    SM00315. RGS. 1 hit.
    [Graphical view]
    SUPFAMiSSF48097. SSF48097. 1 hit.
    SSF50156. SSF50156. 1 hit.
    PROSITEiPS50106. PDZ. 1 hit.
    PS50132. RGS. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P49797-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNRFNGLCKV CSERRYRQIT IRRGKDGFGF TICCDSPVRV QAVDSGGPAE    50
    RAGLQQLDTV LQLNERPVEH WKCVELAHEI RSCPSEIILL VWRVVPQIKP 100
    GPDGGVLRRA SCKSTHDLLS PPNKREKNCT HGAPTRPEQR HSCHLVCDSS 150
    DGLLLGGWER YTEVGKRSGQ HTLPALSRAT TPTDPNYIIL APLNPGSQLL 200
    RPVYQEDAIP EEPGTTTKGK SYTGLGKKSR LMKTVQTMKG HSNYQDCSAL 250
    RPHIPHSSYG TYVTLAPKVL VFPVFVQPLD LCNPARTLLL SEELLLYEGR 300
    NKTSQVTLFA YSDLLLFTKE EEPGRCDVLR NPLYLQSVKL QEGSSEDLKF 350
    CVLYLAEKAE CLFTLEAHSQ EQKKRVCWCL SENIAKQQQL AATPTERKMF 400
    ETEADEKEMP LVEGKGPGAE ERTPSKDPSP SQELPPGQEL PPSKDPSPSQ 450
    ELPPGQELPP SKDPSPSQEL PPGQELPSSK NPSPSQELPA GQDLPPRKES 500
    FSGQEAAPGP ESPSSEDIAT CQNPPQSPET STSKDSPPGQ GSSPTTEVPS 550
    CQGLPAGQES TSQDPLLSQE PPAIPESSAS DQNVLPSQES PPSQGSLSEK 600
    ALAEQTISPG ELPAATAGEP SASRPNFVIP EVRLDSAYSQ QDGAHGGSSG 650
    EDEDAEEGEE GEEGEEDEED DTNDDNYGDR NEAKRSSLIE TGQGAEGGLS 700
    LRVQNSLRRR THSEGSLLQE ARGPCFASDT TLHCSDGEGT TSTWAIPSPR 750
    TLKKELGRNG GSMHHLSLFF TGHRKMSGTD LADDVEASRK RKSKNIAKDM 800
    KNKLAIFRRR NESPGAQPAG KADKTTKSFK PTSEEALKWS ESLEKLLLHK 850
    YGLEVFQAFL RTEFSEENLE FWLACEDFKK VKSQSKMAAK AKKIFAEFIA 900
    IQACKEVNLD SYTREHTKEN LQSITRGCFD LAQKRIFGLM EKDSYPRFLR 950
    SDLYLDLINQ KKMSPPL 967
    Length:967
    Mass (Da):106,380
    Last modified:June 7, 2005 - v2
    Checksum:i5C558885DBA63A5B
    GO
    Isoform 2 (identifier: P49797-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         399-433: MFETEADEKEMPLVEGKGPGAEERTPSKDPSPSQE → KLHPYGSLQQEMGPVTSINATQDRSFTSSGQTLIG
         434-967: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:433
    Mass (Da):48,356
    Checksum:iCFAFB8C48FF97977
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei399 – 43335MFETE…SPSQE → KLHPYGSLQQEMGPVTSINA TQDRSFTSSGQTLIG in isoform 2. 1 PublicationVSP_013971Add
    BLAST
    Alternative sequencei434 – 967534Missing in isoform 2. 1 PublicationVSP_013972Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB055153 mRNA. Translation: BAB63460.1.
    BC085710 mRNA. Translation: AAH85710.1.
    U32434 mRNA. Translation: AAC52371.1.
    RefSeqiNP_062213.1. NM_019340.1. [P49797-1]
    XP_006238327.1. XM_006238265.1. [P49797-2]
    UniGeneiRn.53900.

    Genome annotation databases

    EnsembliENSRNOT00000059181; ENSRNOP00000055954; ENSRNOG00000045849. [P49797-2]
    GeneIDi54293.
    KEGGirno:54293.
    UCSCiRGD:3566. rat. [P49797-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB055153 mRNA. Translation: BAB63460.1 .
    BC085710 mRNA. Translation: AAH85710.1 .
    U32434 mRNA. Translation: AAC52371.1 .
    RefSeqi NP_062213.1. NM_019340.1. [P49797-1 ]
    XP_006238327.1. XM_006238265.1. [P49797-2 ]
    UniGenei Rn.53900.

    3D structure databases

    ProteinModelPortali P49797.
    SMRi P49797. Positions 15-95, 833-959.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 248513. 1 interaction.

    Proteomic databases

    PaxDbi P49797.
    PRIDEi P49797.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSRNOT00000059181 ; ENSRNOP00000055954 ; ENSRNOG00000045849 . [P49797-2 ]
    GeneIDi 54293.
    KEGGi rno:54293.
    UCSCi RGD:3566. rat. [P49797-1 ]

    Organism-specific databases

    CTDi 5998.
    RGDi 3566. Rgs3.

    Phylogenomic databases

    eggNOGi NOG266213.
    GeneTreei ENSGT00750000117382.
    HOGENOMi HOG000154114.
    HOVERGENi HBG013233.
    InParanoidi P49797.
    KOi K07524.
    OMAi TYDLQSP.
    OrthoDBi EOG7VHSZ5.
    PhylomeDBi P49797.

    Miscellaneous databases

    NextBioi 610908.
    PROi P49797.

    Gene expression databases

    Genevestigatori P49797.

    Family and domain databases

    Gene3Di 1.10.196.10. 2 hits.
    2.30.29.30. 1 hit.
    2.30.42.10. 1 hit.
    InterProi IPR001478. PDZ.
    IPR011993. PH_like_dom.
    IPR024066. Regulat_G_prot_signal_dom1.
    IPR016137. Regulat_G_prot_signal_superfam.
    IPR000342. RGS_dom.
    [Graphical view ]
    Pfami PF00595. PDZ. 1 hit.
    PF00615. RGS. 1 hit.
    [Graphical view ]
    PRINTSi PR01301. RGSPROTEIN.
    SMARTi SM00228. PDZ. 1 hit.
    SM00315. RGS. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48097. SSF48097. 1 hit.
    SSF50156. SSF50156. 1 hit.
    PROSITEi PS50106. PDZ. 1 hit.
    PS50132. RGS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of a steroid receptor-binding regulator of G-protein signaling protein cDNA."
      Ikeda M., Hirokawa M., Satani N., Kinoshita T., Watanabe Y., Inoue H., Tone S., Ishikawa T., Minatogawa Y.
      Gene 273:207-214(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH ESR1, TISSUE SPECIFICITY.
      Tissue: Ovary.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Heart.
    3. "EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins."
      Koelle M.R., Horvitz H.R.
      Cell 84:115-125(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 873-939 (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Brain.
    4. "Natriuretic peptides inhibit G protein activation. Mediation through cross-talk between cyclic GMP-dependent protein kinase and regulators of G protein-signaling proteins."
      Pedram A., Razandi M., Kehrl J., Levin E.R.
      J. Biol. Chem. 275:7365-7372(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION.

    Entry informationi

    Entry nameiRGS3_RAT
    AccessioniPrimary (citable) accession number: P49797
    Secondary accession number(s): Q5RKK6, Q920Q9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: June 7, 2005
    Last modified: October 1, 2014
    This is version 105 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3