Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P49797

- RGS3_RAT

UniProt

P49797 - RGS3_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Regulator of G-protein signaling 3

Gene

Rgs3

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.

GO - Molecular functioni

  1. GTPase activator activity Source: RefGenome

GO - Biological processi

  1. positive regulation of GTPase activity Source: GOC
  2. signal transduction Source: RGD
  3. termination of G-protein coupled receptor signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Signal transduction inhibitor

Names & Taxonomyi

Protein namesi
Recommended name:
Regulator of G-protein signaling 3
Short name:
RGS3
Alternative name(s):
SRB-RGS
Gene namesi
Name:Rgs3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 5

Organism-specific databases

RGDi3566. Rgs3.

Subcellular locationi

Cytoplasm By similarity. Membrane By similarity; Peripheral membrane protein By similarity. Nucleus By similarity

GO - Cellular componenti

  1. cytoplasm Source: RefGenome
  2. nucleus Source: UniProtKB-KW
  3. plasma membrane Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 967967Regulator of G-protein signaling 3PRO_0000204184Add
BLAST

Post-translational modificationi

Phosphorylated by cyclic GMP-dependent protein kinase.1 Publication
ISGylated.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP49797.
PRIDEiP49797.

Expressioni

Tissue specificityi

Detected in kidney, uterus, ovary, heart, brain, spleen, lung and testis.2 Publications

Gene expression databases

GenevestigatoriP49797.

Interactioni

Subunit structurei

Binds EFNB1 and EFNB2. Binds the GNB1-GNG2 heterodimer (By similarity). Binds ESR1.By similarity

Protein-protein interaction databases

BioGridi248513. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliP49797.
SMRiP49797. Positions 15-95, 833-959.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini18 – 9578PDZPROSITE-ProRule annotationAdd
BLAST
Domaini842 – 967126RGSPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi424 – 592169Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 RGS domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG266213.
GeneTreeiENSGT00760000118903.
HOGENOMiHOG000154114.
HOVERGENiHBG013233.
InParanoidiP49797.
KOiK07524.
OMAiTYDLQSP.
OrthoDBiEOG7VHSZ5.
PhylomeDBiP49797.

Family and domain databases

Gene3Di1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
IPR011993. PH_like_dom.
IPR024066. Regulat_G_prot_signal_dom1.
IPR016137. Regulat_G_prot_signal_superfam.
IPR000342. RGS_dom.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSiPR01301. RGSPROTEIN.
SMARTiSM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF48097. SSF48097. 1 hit.
SSF50156. SSF50156. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P49797-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNRFNGLCKV CSERRYRQIT IRRGKDGFGF TICCDSPVRV QAVDSGGPAE
60 70 80 90 100
RAGLQQLDTV LQLNERPVEH WKCVELAHEI RSCPSEIILL VWRVVPQIKP
110 120 130 140 150
GPDGGVLRRA SCKSTHDLLS PPNKREKNCT HGAPTRPEQR HSCHLVCDSS
160 170 180 190 200
DGLLLGGWER YTEVGKRSGQ HTLPALSRAT TPTDPNYIIL APLNPGSQLL
210 220 230 240 250
RPVYQEDAIP EEPGTTTKGK SYTGLGKKSR LMKTVQTMKG HSNYQDCSAL
260 270 280 290 300
RPHIPHSSYG TYVTLAPKVL VFPVFVQPLD LCNPARTLLL SEELLLYEGR
310 320 330 340 350
NKTSQVTLFA YSDLLLFTKE EEPGRCDVLR NPLYLQSVKL QEGSSEDLKF
360 370 380 390 400
CVLYLAEKAE CLFTLEAHSQ EQKKRVCWCL SENIAKQQQL AATPTERKMF
410 420 430 440 450
ETEADEKEMP LVEGKGPGAE ERTPSKDPSP SQELPPGQEL PPSKDPSPSQ
460 470 480 490 500
ELPPGQELPP SKDPSPSQEL PPGQELPSSK NPSPSQELPA GQDLPPRKES
510 520 530 540 550
FSGQEAAPGP ESPSSEDIAT CQNPPQSPET STSKDSPPGQ GSSPTTEVPS
560 570 580 590 600
CQGLPAGQES TSQDPLLSQE PPAIPESSAS DQNVLPSQES PPSQGSLSEK
610 620 630 640 650
ALAEQTISPG ELPAATAGEP SASRPNFVIP EVRLDSAYSQ QDGAHGGSSG
660 670 680 690 700
EDEDAEEGEE GEEGEEDEED DTNDDNYGDR NEAKRSSLIE TGQGAEGGLS
710 720 730 740 750
LRVQNSLRRR THSEGSLLQE ARGPCFASDT TLHCSDGEGT TSTWAIPSPR
760 770 780 790 800
TLKKELGRNG GSMHHLSLFF TGHRKMSGTD LADDVEASRK RKSKNIAKDM
810 820 830 840 850
KNKLAIFRRR NESPGAQPAG KADKTTKSFK PTSEEALKWS ESLEKLLLHK
860 870 880 890 900
YGLEVFQAFL RTEFSEENLE FWLACEDFKK VKSQSKMAAK AKKIFAEFIA
910 920 930 940 950
IQACKEVNLD SYTREHTKEN LQSITRGCFD LAQKRIFGLM EKDSYPRFLR
960
SDLYLDLINQ KKMSPPL
Length:967
Mass (Da):106,380
Last modified:June 7, 2005 - v2
Checksum:i5C558885DBA63A5B
GO
Isoform 2 (identifier: P49797-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     399-433: MFETEADEKEMPLVEGKGPGAEERTPSKDPSPSQE → KLHPYGSLQQEMGPVTSINATQDRSFTSSGQTLIG
     434-967: Missing.

Note: No experimental confirmation available.

Show »
Length:433
Mass (Da):48,356
Checksum:iCFAFB8C48FF97977
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei399 – 43335MFETE…SPSQE → KLHPYGSLQQEMGPVTSINA TQDRSFTSSGQTLIG in isoform 2. 1 PublicationVSP_013971Add
BLAST
Alternative sequencei434 – 967534Missing in isoform 2. 1 PublicationVSP_013972Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB055153 mRNA. Translation: BAB63460.1.
BC085710 mRNA. Translation: AAH85710.1.
U32434 mRNA. Translation: AAC52371.1.
RefSeqiNP_062213.1. NM_019340.1. [P49797-1]
XP_006238327.1. XM_006238265.2. [P49797-2]
UniGeneiRn.53900.

Genome annotation databases

EnsembliENSRNOT00000059181; ENSRNOP00000055954; ENSRNOG00000045849. [P49797-2]
GeneIDi54293.
KEGGirno:54293.
UCSCiRGD:3566. rat. [P49797-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB055153 mRNA. Translation: BAB63460.1 .
BC085710 mRNA. Translation: AAH85710.1 .
U32434 mRNA. Translation: AAC52371.1 .
RefSeqi NP_062213.1. NM_019340.1. [P49797-1 ]
XP_006238327.1. XM_006238265.2. [P49797-2 ]
UniGenei Rn.53900.

3D structure databases

ProteinModelPortali P49797.
SMRi P49797. Positions 15-95, 833-959.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 248513. 1 interaction.

Proteomic databases

PaxDbi P49797.
PRIDEi P49797.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000059181 ; ENSRNOP00000055954 ; ENSRNOG00000045849 . [P49797-2 ]
GeneIDi 54293.
KEGGi rno:54293.
UCSCi RGD:3566. rat. [P49797-1 ]

Organism-specific databases

CTDi 5998.
RGDi 3566. Rgs3.

Phylogenomic databases

eggNOGi NOG266213.
GeneTreei ENSGT00760000118903.
HOGENOMi HOG000154114.
HOVERGENi HBG013233.
InParanoidi P49797.
KOi K07524.
OMAi TYDLQSP.
OrthoDBi EOG7VHSZ5.
PhylomeDBi P49797.

Miscellaneous databases

NextBioi 610908.
PROi P49797.

Gene expression databases

Genevestigatori P49797.

Family and domain databases

Gene3Di 1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
InterProi IPR001478. PDZ.
IPR011993. PH_like_dom.
IPR024066. Regulat_G_prot_signal_dom1.
IPR016137. Regulat_G_prot_signal_superfam.
IPR000342. RGS_dom.
[Graphical view ]
Pfami PF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view ]
PRINTSi PR01301. RGSPROTEIN.
SMARTi SM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view ]
SUPFAMi SSF48097. SSF48097. 1 hit.
SSF50156. SSF50156. 1 hit.
PROSITEi PS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of a steroid receptor-binding regulator of G-protein signaling protein cDNA."
    Ikeda M., Hirokawa M., Satani N., Kinoshita T., Watanabe Y., Inoue H., Tone S., Ishikawa T., Minatogawa Y.
    Gene 273:207-214(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH ESR1, TISSUE SPECIFICITY.
    Tissue: Ovary.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Heart.
  3. "EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins."
    Koelle M.R., Horvitz H.R.
    Cell 84:115-125(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 873-939 (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Brain.
  4. "Natriuretic peptides inhibit G protein activation. Mediation through cross-talk between cyclic GMP-dependent protein kinase and regulators of G protein-signaling proteins."
    Pedram A., Razandi M., Kehrl J., Levin E.R.
    J. Biol. Chem. 275:7365-7372(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION.

Entry informationi

Entry nameiRGS3_RAT
AccessioniPrimary (citable) accession number: P49797
Secondary accession number(s): Q5RKK6, Q920Q9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: June 7, 2005
Last modified: October 29, 2014
This is version 106 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3