P49797 (RGS3_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Regulator of G-protein signaling 3 Short name=RGS3 Alternative name(s): SRB-RGS | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 967 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases. |
| Subunit structure | Binds EFNB1 and EFNB2. Binds the GNB1-GNG2 heterodimer By similarity. Binds ESR1. |
| Subcellular location | Cytoplasm By similarity. Membrane; Peripheral membrane protein By similarity. Nucleus By similarity. |
| Tissue specificity | Detected in kidney, uterus, ovary, heart, brain, spleen, lung and testis. Ref.1 Ref.3 |
| Post-translational modification | Phosphorylated by cyclic GMP-dependent protein kinase. Ref.4 ISGylated By similarity. |
| Sequence similarities | Contains 1 PDZ (DHR) domain. Contains 1 RGS domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Signal transduction inhibitor |
| PTM | Phosphoprotein Ubl conjugation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | signal transduction Inferred from direct assay PubMed 12006602. Source: RGD termination of G-protein coupled receptor signaling pathwayInferred from electronic annotation. Source: InterPro |
| Cellular_component | cytoplasm Inferred from Biological aspect of Ancestor. Source: RefGenome nucleusInferred from electronic annotation. Source: UniProtKB-SubCell plasma membraneInferred from Biological aspect of Ancestor. Source: RefGenome |
| Molecular_function | GTPase activator activity Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P49797-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P49797-2) The sequence of this isoform differs from the canonical sequence as follows: 399-433: MFETEADEKEMPLVEGKGPGAEERTPSKDPSPSQE → KLHPYGSLQQEMGPVTSINATQDRSFTSSGQTLIG 434-967: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 967 | 967 | Regulator of G-protein signaling 3 | PRO_0000204184 | |||||
Regions | |||||||||
| Domain | 18 – 95 | 78 | PDZ | ||||||
| Domain | 842 – 967 | 126 | RGS | ||||||
| Compositional bias | 424 – 592 | 169 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 713 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 716 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 399 – 433 | 35 | MFETE…SPSQE → KLHPYGSLQQEMGPVTSINA TQDRSFTSSGQTLIG in isoform 2. | VSP_013971 | |||||
| Alternative sequence | 434 – 967 | 534 | Missing in isoform 2. | VSP_013972 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a steroid receptor-binding regulator of G-protein signaling protein cDNA." Ikeda M., Hirokawa M., Satani N., Kinoshita T., Watanabe Y., Inoue H., Tone S., Ishikawa T., Minatogawa Y. Gene 273:207-214(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH ESR1, TISSUE SPECIFICITY. Tissue: Ovary. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Heart. |
| [3] | "EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins." Koelle M.R., Horvitz H.R. Cell 84:115-125(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 873-939 (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Brain. |
| [4] | "Natriuretic peptides inhibit G protein activation. Mediation through cross-talk between cyclic GMP-dependent protein kinase and regulators of G protein-signaling proteins." Pedram A., Razandi M., Kehrl J., Levin E.R. J. Biol. Chem. 275:7365-7372(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB055153 mRNA. Translation: BAB63460.1. BC085710 mRNA. Translation: AAH85710.1. U32434 mRNA. Translation: AAC52371.1. |
| IPI | IPI00200849. IPI00209528. |
| RefSeq | NP_062213.1. NM_019340.1. |
| UniGene | Rn.53900. |
3D structure databases | |
| ProteinModelPortal | P49797. |
| SMR | P49797. Positions 15-95, 833-959. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | P49797. |
| PRIDE | P49797. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000059181; ENSRNOP00000055954; ENSRNOG00000045849. |
| GeneID | 54293. |
| KEGG | rno:54293. |
| UCSC | RGD:3566. rat. |
Organism-specific databases | |
| CTD | 5998. |
| RGD | 3566. Rgs3. |
Phylogenomic databases | |
| eggNOG | NOG266213. |
| GeneTree | ENSGT00690000101738. |
| HOGENOM | HOG000154114. |
| HOVERGEN | HBG013233. |
| InParanoid | P49797. |
| KO | K07524. |
Gene expression databases | |
| ArrayExpress | P49797. |
| Genevestigator | P49797. |
| GermOnline | ENSRNOG00000024501. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 1.10.196.10. 2 hits. 2.30.29.30. 1 hit. |
| InterPro | IPR001478. PDZ. IPR011993. PH_like_dom. IPR000342. Regulat_G_prot_signal. IPR024066. Regulat_G_prot_signal_dom1. IPR016137. Regulat_G_prot_signal_superfam. [Graphical view] |
| Pfam | PF00595. PDZ. 1 hit. PF00615. RGS. 1 hit. [Graphical view] |
| PRINTS | PR01301. RGSPROTEIN. |
| SMART | SM00228. PDZ. 1 hit. SM00315. RGS. 1 hit. [Graphical view] |
| SUPFAM | SSF50156. PDZ. 1 hit. SSF48097. Regulat_G_prot_signal_superfam. 1 hit. |
| PROSITE | PS50106. PDZ. 1 hit. PS50132. RGS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 610908. |
Entry information
| Entry name | RGS3_RAT | ||||||||
| Accession | Primary (citable) accession number: P49797 Secondary accession number(s): Q5RKK6, Q920Q9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
