Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P49796 (RGS3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 152. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Regulator of G-protein signaling 3

Short name=RGP3
Short name=RGS3
Gene names
Name:RGS3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1198 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases. Ref.1 Ref.9 Ref.10 Ref.11

Subunit structure

Binds EFNB1 and EFNB2 By similarity. Binds the GNB1-GNG2 heterodimer.

Subcellular location

Cytoplasm. Nucleus. Cell membrane; Peripheral membrane protein Potential. Note: Long isoforms are cytoplasmic and associated with the plasma membrane. Short isoforms are nuclear. Ref.9 Ref.10 Ref.11

Post-translational modification

Phosphorylated by cyclic GMP-dependent protein kinase By similarity.

ISGylated Probable. Ref.12

Sequence similarities

Contains 1 C2 domain.

Contains 1 PDZ (DHR) domain.

Contains 1 RGS domain.

Alternative products

This entry describes 9 isoforms produced by alternative splicing. [Align] [Select]
Isoform 3 (identifier: P49796-3)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 (identifier: P49796-1)

The sequence of this isoform differs from the canonical sequence as follows:
     1-679: Missing.
Isoform 2 (identifier: P49796-2)

Also known as: RGS3T;

The sequence of this isoform differs from the canonical sequence as follows:
     1-992: Missing.
Note: Nuclear.
Isoform 4 (identifier: P49796-4)

Also known as: 1;

The sequence of this isoform differs from the canonical sequence as follows:
     1-281: Missing.
     282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ
Isoform 5 (identifier: P49796-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-112: Missing.
     113-138: ALPRRDEWTQTSPARKRITHAKVQGA → MERSLHRVSLGSRRAHPDLSFYLTTF
     680-714: MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQ → KLHPFGSLQQEMGPVNSTNATQDRSFTSPGQTLIG
     715-1198: Missing.
Isoform 6 (identifier: P49796-6)

Also known as: C2PA-RGS3;

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.
Isoform 7 (identifier: P49796-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE
Note: No experimental confirmation available.
Isoform 8 (identifier: P49796-8)

Also known as: RGS3S;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE
     1198-1198: L → LDYKDDDDK
Isoform 9 (identifier: P49796-9)

The sequence of this isoform differs from the canonical sequence as follows:
     1-281: Missing.
     282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ
     679-1004: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 11981198Regulator of G-protein signaling 3
PRO_0000204182

Regions

Domain137 – 239103C2
Domain299 – 37678PDZ
Domain1073 – 1198126RGS
Compositional bias705 – 819115Pro-rich

Natural variations

Alternative sequence1 – 10271027MPVIP…KSKNL → MVTRRPVTNSWDWLPAGAAP EAVPCRHMPLSRLPLRVGQK EFFFPLPLLVPPISWLLLSE SQPRLVPGSPVIRPGFQRAC VAAACTVAARCPGRGVGDRS QSGASYRPICGPKVGGPTEM LRGMYLTRNGNLQRRHTMKE in isoform 7 and isoform 8.
VSP_047029
Alternative sequence1 – 992992Missing in isoform 2.
VSP_005662
Alternative sequence1 – 679679Missing in isoform 1.
VSP_013958
Alternative sequence1 – 281281Missing in isoform 4 and isoform 9.
VSP_013959
Alternative sequence1 – 112112Missing in isoform 5.
VSP_013961
Alternative sequence1 – 104104Missing in isoform 6.
VSP_013960
Alternative sequence113 – 13826ALPRR…KVQGA → MERSLHRVSLGSRRAHPDLS FYLTTF in isoform 5.
VSP_013962
Alternative sequence282 – 29918PLLRM…GKKLK → MNRFNGLCKVCSERRYRQ in isoform 4 and isoform 9.
VSP_013963
Alternative sequence679 – 1004326Missing in isoform 9.
VSP_054690
Alternative sequence680 – 71435MFETE…PSPGQ → KLHPFGSLQQEMGPVNSTNA TQDRSFTSPGQTLIG in isoform 5.
VSP_013964
Alternative sequence715 – 1198484Missing in isoform 5.
VSP_013965
Alternative sequence11981L → LDYKDDDDK in isoform 8.
VSP_053533
Natural variant1291R → K.
Corresponds to variant rs16933949 [ dbSNP | Ensembl ].
VAR_051794
Natural variant8091R → Q.
Corresponds to variant rs41305473 [ dbSNP | Ensembl ].
VAR_061769

Experimental info

Sequence conflict1701C → W in AAM33254. Ref.2
Sequence conflict2061F → S in BAC11328. Ref.3
Sequence conflict2661T → A in AAM33254. Ref.2
Sequence conflict4621A → V in AAL68829. Ref.4
Sequence conflict5851A → V in AAM33255. Ref.2
Sequence conflict6321C → R in BAC11328. Ref.3
Sequence conflict7051Missing in AAM33254. Ref.2
Sequence conflict7251N → S in AAH42555. Ref.8
Sequence conflict8731Q → H in AAM33254. Ref.2
Sequence conflict883 – 8842EE → KQ in AAM33254. Ref.2
Sequence conflict9841K → R in AAM12641. Ref.5
Sequence conflict11271A → V in AAM33253. Ref.2

Secondary structure

.......................................................... 1198
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 3 [UniParc].

Last modified June 7, 2005. Version 2.
Checksum: E615DA49022EFFE4

FASTA1,198132,336
        10         20         30         40         50         60 
MPVIPALWEV EMGRSQGQEI ETILANRSHS DSTPLPNFLS GSHRPECCTC RLLTASGAQD 

        70         80         90        100        110        120 
SLPFGRRLYS GPWRSCEEVC HVSVLSVLST SCGLSLSLPI FPGWMEWLSP DIALPRRDEW 

       130        140        150        160        170        180 
TQTSPARKRI THAKVQGAGQ LRLSIDAQDR VLLLHIIEGK GLISKQPGTC DPYVKISLIP 

       190        200        210        220        230        240 
EDSRLRHQKT QTVPDCRDPA FHEHFFFPVQ EEDDQKRLLV TVWNRASQSR QSGLIGCMSF 

       250        260        270        280        290        300 
GVKSLLTPDK EISGWYYLLG EHLGRTKHLK VARRRLRPLR DPLLRMPGGG DTENGKKLKI 

       310        320        330        340        350        360 
TIPRGKDGFG FTICCDSPVR VQAVDSGGPA ERAGLQQLDT VLQLNERPVE HWKCVELAHE 

       370        380        390        400        410        420 
IRSCPSEIIL LVWRMVPQVK PGPDGGVLRR ASCKSTHDLQ SPPNKREKNC THGVQARPEQ 

       430        440        450        460        470        480 
RHSCHLVCDS SDGLLLGGWE RYTEVAKRGG QHTLPALSRA TAPTDPNYII LAPLNPGSQL 

       490        500        510        520        530        540 
LRPVYQEDTI PEESGSPSKG KSYTGLGKKS RLMKTVQTMK GHGNYQNCPV VRPHATHSSY 

       550        560        570        580        590        600 
GTYVTLAPKV LVFPVFVQPL DLCNPARTLL LSEELLLYEG RNKAAEVTLF AYSDLLLFTK 

       610        620        630        640        650        660 
EDEPGRCDVL RNPLYLQSVK LQEGSSEDLK FCVLYLAEKA ECLFTLEAHS QEQKKRVCWC 

       670        680        690        700        710        720 
LSENIAKQQQ LAASPPDSKM FETEADEKRE MALEEGKGPG AEDSPPSKEP SPGQELPPGQ 

       730        740        750        760        770        780 
DLPPNKDSPS GQEPAPSQEP LSSKDSATSE GSPPGPDAPP SKDVPPCQEP PPAQDLSPCQ 

       790        800        810        820        830        840 
DLPAGQEPLP HQDPLLTKDL PAIQESPTRD LPPCQDLPPS QVSLPAKALT EDTMSSGDLL 

       850        860        870        880        890        900 
AATGDPPAAP RPAFVIPEVR LDSTYSQKAG AEQGCSGDEE DAEEAEEVEE GEEGEEDEDE 

       910        920        930        940        950        960 
DTSDDNYGER SEAKRSSMIE TGQGAEGGLS LRVQNSLRRR THSEGSLLQE PRGPCFASDT 

       970        980        990       1000       1010       1020 
TLHCSDGEGA ASTWGMPSPS TLKKELGRNG GSMHHLSLFF TGHRKMSGAD TVGDDDEASR 

      1030       1040       1050       1060       1070       1080 
KRKSKNLAKD MKNKLGIFRR RNESPGAPPA GKADKMMKSF KPTSEEALKW GESLEKLLVH 

      1090       1100       1110       1120       1130       1140 
KYGLAVFQAF LRTEFSEENL EFWLACEDFK KVKSQSKMAS KAKKIFAEYI AIQACKEVNL 

      1150       1160       1170       1180       1190 
DSYTREHTKD NLQSVTRGCF DLAQKRIFGL MEKDSYPRFL RSDLYLDLIN QKKMSPPL 

« Hide

Isoform 1 [UniParc].

Checksum: F1CFE3F27D4673A0
Show »

FASTA51956,602
Isoform 2 (RGS3T) [UniParc].

Checksum: E24047B4952692D4
Show »

FASTA20623,725
Isoform 4 (1) [UniParc].

Checksum: 17D77BE23D0A1C52
Show »

FASTA917100,948
Isoform 5 [UniParc].

Checksum: 1976A77C3FC3933F
Show »

FASTA60267,282
Isoform 6 (C2PA-RGS3) [UniParc].

Checksum: 9465608DAA6F95B6
Show »

FASTA1,094121,008
Isoform 7 [UniParc].

Checksum: 6886A35CF3ADF13E
Show »

FASTA31135,108
Isoform 8 (RGS3S) [UniParc].

Checksum: B667E606719743CF
Show »

FASTA31936,103
Isoform 9 [UniParc].

Checksum: 379E2AA9DB27D837
Show »

FASTA59166,478

References

« Hide 'large scale' references
[1]"Inhibition of G-protein-mediated MAP kinase activation by a new mammalian gene family."
Druey K.M., Blumer K.J., Kang V.H., Kehrl J.H.
Nature 379:742-746(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
[2]"Additional 5' exons in the RGS3 locus generate multiple mRNA transcripts, one of which accounts for the origin of human PDZ-RGS3."
Kehrl J.H., Srikumar D., Harrison K., Wilson G.L., Shi C.S.
Genomics 79:860-868(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4; 6 AND 8), NUCLEOTIDE SEQUENCE [MRNA] OF 105-1198 (ISOFORM 1).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 5 AND 9).
Tissue: Amygdala and Testis.
[4]"Human PDZ-RGS3."
Chatterjee T.K., Fisher R.A.
Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 4).
[5]"cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
Puhl H.L. III, Ikeda S.R., Aronstam R.S.
Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain.
[6]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
Tissue: Brain and Kidney.
[9]"RGS3 inhibits G protein-mediated signaling via translocation to the membrane and binding to Galpha11."
Dulin N.O., Sorokin A., Reed E., Elliott S., Kehrl J.H., Dunn M.J.
Mol. Cell. Biol. 19:714-723(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH GNA11 AND GNA13, SUBCELLULAR LOCATION.
[10]"Regulator of G protein signaling RGS3T is localized to the nucleus and induces apoptosis."
Dulin N.O., Pratt P., Tiruppathi C., Niu J., Voyno-Yasenetskaya T., Dunn M.J.
J. Biol. Chem. 275:21317-21323(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION.
[11]"Regulator of G-protein signaling 3 (RGS3) inhibits G-beta1/gamma2-induced inositol phosphate production, mitogen-activated protein kinase activation, and Akt activation."
Shi C.-S., Lee S.B., Sinnarajah S., Dessauer C.W., Rhee S.G., Kehrl J.H.
J. Biol. Chem. 276:24293-24300(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH HETERODIMERIC GNB1-GNG2, SUBCELLULAR LOCATION.
[12]"Identification and Herc5-mediated ISGylation of novel target proteins."
Takeuchi T., Inoue S., Yokosawa H.
Biochem. Biophys. Res. Commun. 348:473-477(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: ISGYLATION.
[13]"Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line."
Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S.
Electrophoresis 28:2027-2034(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Prostate cancer.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U27655 mRNA. Translation: AAC50394.1.
AF490838 mRNA. Translation: AAM33253.1.
AF490839 mRNA. Translation: AAM33254.1.
AF490840 mRNA. Translation: AAM33255.1.
AK074977 mRNA. Translation: BAC11328.1.
AK096840 mRNA. Translation: BAG53374.1.
AK128127 mRNA. Translation: BAC87285.1.
AK289666 mRNA. Translation: BAF82355.1.
AF493927 mRNA. Translation: AAM12641.1.
AF493941 mRNA. Translation: AAM12655.1.
AY585192 mRNA. Translation: AAT79495.1.
AF463495 Genomic DNA. Translation: AAL68829.1.
AL162727 Genomic DNA. Translation: CAC78977.1.
AL162727, AL359455 Genomic DNA. Translation: CAH70841.1.
AL162727, AL137066, AL359455 Genomic DNA. Translation: CAH70843.1.
AL137066, AL162727, AL359455 Genomic DNA. Translation: CAH70102.1.
AL137066, AL359455 Genomic DNA. Translation: CAH70103.1.
AL359455, AL137066 Genomic DNA. Translation: CAH73880.1.
AL359455, AL162727 Genomic DNA. Translation: CAH73877.1.
AL359455, AL137066, AL162727 Genomic DNA. Translation: CAH73879.1.
CH471090 Genomic DNA. Translation: EAW87388.1.
CH471090 Genomic DNA. Translation: EAW87391.1.
CH471090 Genomic DNA. Translation: EAW87393.1.
BC019039 mRNA. Translation: AAH19039.3.
BC042555 mRNA. Translation: AAH42555.1.
CCDSCCDS35113.1. [P49796-5]
CCDS35114.1. [P49796-7]
CCDS43869.1. [P49796-3]
CCDS6797.1. [P49796-4]
CCDS6798.1. [P49796-1]
PIRS78089.
RefSeqNP_001263189.1. NM_001276260.1. [P49796-1]
NP_001263190.1. NM_001276261.1. [P49796-9]
NP_001263191.1. NM_001276262.1.
NP_001269851.1. NM_001282922.1. [P49796-1]
NP_001269852.1. NM_001282923.1.
NP_060260.3. NM_017790.4. [P49796-5]
NP_570613.2. NM_130795.3. [P49796-4]
NP_602299.1. NM_134427.2.
NP_652759.3. NM_144488.5. [P49796-3]
NP_652760.2. NM_144489.3. [P49796-7]
XP_006717282.1. XM_006717219.1. [P49796-6]
XP_006717289.1. XM_006717226.1. [P49796-1]
XP_006717290.1. XM_006717227.1. [P49796-1]
XP_006717291.1. XM_006717228.1. [P49796-1]
XP_006717292.1. XM_006717229.1. [P49796-1]
XP_006717293.1. XM_006717230.1. [P49796-1]
UniGeneHs.494875.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2F5YX-ray2.39A/B300-384[»]
2OJ4X-ray2.30A1064-1190[»]
3FBKX-ray2.00A/B134-276[»]
ProteinModelPortalP49796.
SMRP49796. Positions 136-275, 299-376, 1064-1190.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid111930. 15 interactions.
IntActP49796. 16 interactions.
MINTMINT-136831.

PTM databases

PhosphoSiteP49796.

Polymorphism databases

DMDM67477383.

Proteomic databases

MaxQBP49796.
PaxDbP49796.
PRIDEP49796.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000317613; ENSP00000312844; ENSG00000138835. [P49796-5]
ENST00000343817; ENSP00000340284; ENSG00000138835. [P49796-4]
ENST00000350696; ENSP00000259406; ENSG00000138835. [P49796-3]
ENST00000374134; ENSP00000363249; ENSG00000138835. [P49796-1]
ENST00000374140; ENSP00000363255; ENSG00000138835. [P49796-3]
ENST00000394646; ENSP00000378141; ENSG00000138835.
ENST00000462143; ENSP00000420356; ENSG00000138835. [P49796-1]
ENST00000462403; ENSP00000436168; ENSG00000138835. [P49796-7]
GeneID5998.
KEGGhsa:5998.
UCSCuc004bhq.4. human. [P49796-3]
uc004bhr.4. human. [P49796-5]
uc004bht.4. human. [P49796-4]
uc004bhv.4. human. [P49796-1]

Organism-specific databases

CTD5998.
GeneCardsGC09P116207.
HGNCHGNC:9999. RGS3.
HPACAB032507.
MIM602189. gene.
neXtProtNX_P49796.
PharmGKBPA34374.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG266213.
HOVERGENHBG013233.
InParanoidP49796.
KOK07524.
OMAQEPRGPC.
OrthoDBEOG7VHSZ5.
PhylomeDBP49796.
TreeFamTF351952.

Gene expression databases

ArrayExpressP49796.
BgeeP49796.
GenevestigatorP49796.

Family and domain databases

Gene3D1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
2.60.40.150. 1 hit.
InterProIPR000008. C2_dom.
IPR001478. PDZ.
IPR011993. PH_like_dom.
IPR024066. Regulat_G_prot_signal_dom1.
IPR016137. Regulat_G_prot_signal_superfam.
IPR000342. RGS_dom.
[Graphical view]
PfamPF00168. C2. 1 hit.
PF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSPR01301. RGSPROTEIN.
SMARTSM00239. C2. 1 hit.
SM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMSSF48097. SSF48097. 1 hit.
SSF49562. SSF49562. 1 hit.
SSF50156. SSF50156. 1 hit.
PROSITEPS50004. C2. 1 hit.
PS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSRGS3. human.
EvolutionaryTraceP49796.
GeneWikiRGS3.
GenomeRNAi5998.
NextBio23375.
PROP49796.
SOURCESearch...

Entry information

Entry nameRGS3_HUMAN
AccessionPrimary (citable) accession number: P49796
Secondary accession number(s): A6NHA0 expand/collapse secondary AC list , A8K0V1, B3KUB2, Q5VXB8, Q5VXC1, Q5VZ05, Q5VZ06, Q6ZRM5, Q8IUQ1, Q8NC47, Q8NFN4, Q8NFN5, Q8NFN6, Q8TD59, Q8TD68, Q8WV02, Q8WXA0
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: June 7, 2005
Last modified: July 9, 2014
This is version 152 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM