Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P49796

- RGS3_HUMAN

UniProt

P49796 - RGS3_HUMAN

Protein

Regulator of G-protein signaling 3

Gene

RGS3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 154 (01 Oct 2014)
      Sequence version 2 (07 Jun 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.4 Publications

    GO - Molecular functioni

    1. GTPase activator activity Source: RefGenome

    GO - Biological processi

    1. inactivation of MAPK activity Source: ProtInc
    2. positive regulation of GTPase activity Source: GOC
    3. regulation of G-protein coupled receptor protein signaling pathway Source: ProtInc
    4. termination of G-protein coupled receptor signaling pathway Source: InterPro

    Keywords - Molecular functioni

    Signal transduction inhibitor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Regulator of G-protein signaling 3
    Short name:
    RGP3
    Short name:
    RGS3
    Gene namesi
    Name:RGS3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:9999. RGS3.

    Subcellular locationi

    Cytoplasm. Nucleus. Cell membrane Curated; Peripheral membrane protein Curated
    Note: Long isoforms are cytoplasmic and associated with the plasma membrane. Short isoforms are nuclear.

    GO - Cellular componenti

    1. cytoplasm Source: RefGenome
    2. cytosol Source: ProtInc
    3. nucleus Source: UniProtKB-SubCell
    4. plasma membrane Source: RefGenome

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Membrane, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA34374.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11981198Regulator of G-protein signaling 3PRO_0000204182Add
    BLAST

    Post-translational modificationi

    Phosphorylated by cyclic GMP-dependent protein kinase.By similarity
    ISGylated.1 Publication

    Keywords - PTMi

    Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiP49796.
    PaxDbiP49796.
    PRIDEiP49796.

    PTM databases

    PhosphoSiteiP49796.

    Expressioni

    Gene expression databases

    ArrayExpressiP49796.
    BgeeiP49796.
    GenevestigatoriP49796.

    Organism-specific databases

    HPAiCAB032507.

    Interactioni

    Subunit structurei

    Binds EFNB1 and EFNB2 By similarity. Binds the GNB1-GNG2 heterodimer.By similarity

    Protein-protein interaction databases

    BioGridi111930. 15 interactions.
    IntActiP49796. 16 interactions.
    MINTiMINT-136831.

    Structurei

    Secondary structure

    1
    1198
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi140 – 16122
    Beta strandi166 – 1683
    Beta strandi172 – 1809
    Beta strandi200 – 2089
    Helixi211 – 2133
    Beta strandi216 – 2249
    Helixi229 – 2313
    Beta strandi233 – 2419
    Helixi242 – 2454
    Beta strandi252 – 2576
    Helixi263 – 2653
    Beta strandi300 – 3034
    Beta strandi310 – 3145
    Beta strandi316 – 3183
    Beta strandi320 – 3245
    Helixi329 – 3335
    Beta strandi340 – 3445
    Helixi354 – 3629
    Beta strandi365 – 37410
    Helixi1066 – 10705
    Helixi1074 – 10785
    Helixi1081 – 109313
    Helixi1097 – 110913
    Helixi1115 – 112915
    Helixi1142 – 11509
    Turni1157 – 11604
    Helixi1161 – 117313
    Helixi1175 – 11817
    Helixi1183 – 11864
    Turni1187 – 11893

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2F5YX-ray2.39A/B300-384[»]
    2OJ4X-ray2.30A1064-1190[»]
    3FBKX-ray2.00A/B134-276[»]
    ProteinModelPortaliP49796.
    SMRiP49796. Positions 136-275, 299-376, 1064-1190.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP49796.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini137 – 239103C2PROSITE-ProRule annotationAdd
    BLAST
    Domaini299 – 37678PDZPROSITE-ProRule annotationAdd
    BLAST
    Domaini1073 – 1198126RGSPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi705 – 819115Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C2 domain.PROSITE-ProRule annotation
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
    Contains 1 RGS domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG266213.
    HOVERGENiHBG013233.
    InParanoidiP49796.
    KOiK07524.
    OMAiQEPRGPC.
    OrthoDBiEOG7VHSZ5.
    PhylomeDBiP49796.
    TreeFamiTF351952.

    Family and domain databases

    Gene3Di1.10.196.10. 2 hits.
    2.30.29.30. 1 hit.
    2.30.42.10. 1 hit.
    2.60.40.150. 1 hit.
    InterProiIPR000008. C2_dom.
    IPR001478. PDZ.
    IPR011993. PH_like_dom.
    IPR024066. Regulat_G_prot_signal_dom1.
    IPR016137. Regulat_G_prot_signal_superfam.
    IPR000342. RGS_dom.
    [Graphical view]
    PfamiPF00168. C2. 1 hit.
    PF00595. PDZ. 1 hit.
    PF00615. RGS. 1 hit.
    [Graphical view]
    PRINTSiPR01301. RGSPROTEIN.
    SMARTiSM00239. C2. 1 hit.
    SM00228. PDZ. 1 hit.
    SM00315. RGS. 1 hit.
    [Graphical view]
    SUPFAMiSSF48097. SSF48097. 1 hit.
    SSF49562. SSF49562. 1 hit.
    SSF50156. SSF50156. 1 hit.
    PROSITEiPS50004. C2. 1 hit.
    PS50106. PDZ. 1 hit.
    PS50132. RGS. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 3 (identifier: P49796-3) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPVIPALWEV EMGRSQGQEI ETILANRSHS DSTPLPNFLS GSHRPECCTC     50
    RLLTASGAQD SLPFGRRLYS GPWRSCEEVC HVSVLSVLST SCGLSLSLPI 100
    FPGWMEWLSP DIALPRRDEW TQTSPARKRI THAKVQGAGQ LRLSIDAQDR 150
    VLLLHIIEGK GLISKQPGTC DPYVKISLIP EDSRLRHQKT QTVPDCRDPA 200
    FHEHFFFPVQ EEDDQKRLLV TVWNRASQSR QSGLIGCMSF GVKSLLTPDK 250
    EISGWYYLLG EHLGRTKHLK VARRRLRPLR DPLLRMPGGG DTENGKKLKI 300
    TIPRGKDGFG FTICCDSPVR VQAVDSGGPA ERAGLQQLDT VLQLNERPVE 350
    HWKCVELAHE IRSCPSEIIL LVWRMVPQVK PGPDGGVLRR ASCKSTHDLQ 400
    SPPNKREKNC THGVQARPEQ RHSCHLVCDS SDGLLLGGWE RYTEVAKRGG 450
    QHTLPALSRA TAPTDPNYII LAPLNPGSQL LRPVYQEDTI PEESGSPSKG 500
    KSYTGLGKKS RLMKTVQTMK GHGNYQNCPV VRPHATHSSY GTYVTLAPKV 550
    LVFPVFVQPL DLCNPARTLL LSEELLLYEG RNKAAEVTLF AYSDLLLFTK 600
    EDEPGRCDVL RNPLYLQSVK LQEGSSEDLK FCVLYLAEKA ECLFTLEAHS 650
    QEQKKRVCWC LSENIAKQQQ LAASPPDSKM FETEADEKRE MALEEGKGPG 700
    AEDSPPSKEP SPGQELPPGQ DLPPNKDSPS GQEPAPSQEP LSSKDSATSE 750
    GSPPGPDAPP SKDVPPCQEP PPAQDLSPCQ DLPAGQEPLP HQDPLLTKDL 800
    PAIQESPTRD LPPCQDLPPS QVSLPAKALT EDTMSSGDLL AATGDPPAAP 850
    RPAFVIPEVR LDSTYSQKAG AEQGCSGDEE DAEEAEEVEE GEEGEEDEDE 900
    DTSDDNYGER SEAKRSSMIE TGQGAEGGLS LRVQNSLRRR THSEGSLLQE 950
    PRGPCFASDT TLHCSDGEGA ASTWGMPSPS TLKKELGRNG GSMHHLSLFF 1000
    TGHRKMSGAD TVGDDDEASR KRKSKNLAKD MKNKLGIFRR RNESPGAPPA 1050
    GKADKMMKSF KPTSEEALKW GESLEKLLVH KYGLAVFQAF LRTEFSEENL 1100
    EFWLACEDFK KVKSQSKMAS KAKKIFAEYI AIQACKEVNL DSYTREHTKD 1150
    NLQSVTRGCF DLAQKRIFGL MEKDSYPRFL RSDLYLDLIN QKKMSPPL 1198
    Length:1,198
    Mass (Da):132,336
    Last modified:June 7, 2005 - v2
    Checksum:iE615DA49022EFFE4
    GO
    Isoform 1 (identifier: P49796-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-679: Missing.

    Show »
    Length:519
    Mass (Da):56,602
    Checksum:iF1CFE3F27D4673A0
    GO
    Isoform 2 (identifier: P49796-2) [UniParc]FASTAAdd to Basket

    Also known as: RGS3T

    The sequence of this isoform differs from the canonical sequence as follows:
         1-992: Missing.

    Note: Nuclear.

    Show »
    Length:206
    Mass (Da):23,725
    Checksum:iE24047B4952692D4
    GO
    Isoform 4 (identifier: P49796-4) [UniParc]FASTAAdd to Basket

    Also known as: 1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-281: Missing.
         282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ

    Show »
    Length:917
    Mass (Da):100,948
    Checksum:i17D77BE23D0A1C52
    GO
    Isoform 5 (identifier: P49796-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-112: Missing.
         113-138: ALPRRDEWTQTSPARKRITHAKVQGA → MERSLHRVSLGSRRAHPDLSFYLTTF
         680-714: MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQ → KLHPFGSLQQEMGPVNSTNATQDRSFTSPGQTLIG
         715-1198: Missing.

    Show »
    Length:602
    Mass (Da):67,282
    Checksum:i1976A77C3FC3933F
    GO
    Isoform 6 (identifier: P49796-6) [UniParc]FASTAAdd to Basket

    Also known as: C2PA-RGS3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-104: Missing.

    Show »
    Length:1,094
    Mass (Da):121,008
    Checksum:i9465608DAA6F95B6
    GO
    Isoform 7 (identifier: P49796-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE

    Note: No experimental confirmation available.

    Show »
    Length:311
    Mass (Da):35,108
    Checksum:i6886A35CF3ADF13E
    GO
    Isoform 8 (identifier: P49796-8) [UniParc]FASTAAdd to Basket

    Also known as: RGS3S

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE
         1198-1198: L → LDYKDDDDK

    Show »
    Length:319
    Mass (Da):36,103
    Checksum:iB667E606719743CF
    GO
    Isoform 9 (identifier: P49796-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-281: Missing.
         282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ
         679-1004: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:591
    Mass (Da):66,478
    Checksum:i379E2AA9DB27D837
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti170 – 1701C → W in AAM33254. (PubMed:12036301)Curated
    Sequence conflicti206 – 2061F → S in BAC11328. (PubMed:14702039)Curated
    Sequence conflicti266 – 2661T → A in AAM33254. (PubMed:12036301)Curated
    Sequence conflicti462 – 4621A → V in AAL68829. 1 PublicationCurated
    Sequence conflicti585 – 5851A → V in AAM33255. (PubMed:12036301)Curated
    Sequence conflicti632 – 6321C → R in BAC11328. (PubMed:14702039)Curated
    Sequence conflicti705 – 7051Missing in AAM33254. (PubMed:12036301)Curated
    Sequence conflicti725 – 7251N → S in AAH42555. (PubMed:15489334)Curated
    Sequence conflicti873 – 8731Q → H in AAM33254. (PubMed:12036301)Curated
    Sequence conflicti883 – 8842EE → KQ in AAM33254. (PubMed:12036301)Curated
    Sequence conflicti984 – 9841K → R in AAM12641. 1 PublicationCurated
    Sequence conflicti1127 – 11271A → V in AAM33253. (PubMed:12036301)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti129 – 1291R → K.
    Corresponds to variant rs16933949 [ dbSNP | Ensembl ].
    VAR_051794
    Natural varianti809 – 8091R → Q.
    Corresponds to variant rs41305473 [ dbSNP | Ensembl ].
    VAR_061769

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 10271027MPVIP…KSKNL → MVTRRPVTNSWDWLPAGAAP EAVPCRHMPLSRLPLRVGQK EFFFPLPLLVPPISWLLLSE SQPRLVPGSPVIRPGFQRAC VAAACTVAARCPGRGVGDRS QSGASYRPICGPKVGGPTEM LRGMYLTRNGNLQRRHTMKE in isoform 7 and isoform 8. 1 PublicationVSP_047029Add
    BLAST
    Alternative sequencei1 – 992992Missing in isoform 2. 1 PublicationVSP_005662Add
    BLAST
    Alternative sequencei1 – 679679Missing in isoform 1. 4 PublicationsVSP_013958Add
    BLAST
    Alternative sequencei1 – 281281Missing in isoform 4 and isoform 9. 5 PublicationsVSP_013959Add
    BLAST
    Alternative sequencei1 – 112112Missing in isoform 5. 1 PublicationVSP_013961Add
    BLAST
    Alternative sequencei1 – 104104Missing in isoform 6. 1 PublicationVSP_013960Add
    BLAST
    Alternative sequencei113 – 13826ALPRR…KVQGA → MERSLHRVSLGSRRAHPDLS FYLTTF in isoform 5. 1 PublicationVSP_013962Add
    BLAST
    Alternative sequencei282 – 29918PLLRM…GKKLK → MNRFNGLCKVCSERRYRQ in isoform 4 and isoform 9. 5 PublicationsVSP_013963Add
    BLAST
    Alternative sequencei679 – 1004326Missing in isoform 9. 1 PublicationVSP_054690Add
    BLAST
    Alternative sequencei680 – 71435MFETE…PSPGQ → KLHPFGSLQQEMGPVNSTNA TQDRSFTSPGQTLIG in isoform 5. 1 PublicationVSP_013964Add
    BLAST
    Alternative sequencei715 – 1198484Missing in isoform 5. 1 PublicationVSP_013965Add
    BLAST
    Alternative sequencei1198 – 11981L → LDYKDDDDK in isoform 8. 1 PublicationVSP_053533

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U27655 mRNA. Translation: AAC50394.1.
    AF490838 mRNA. Translation: AAM33253.1.
    AF490839 mRNA. Translation: AAM33254.1.
    AF490840 mRNA. Translation: AAM33255.1.
    AK074977 mRNA. Translation: BAC11328.1.
    AK096840 mRNA. Translation: BAG53374.1.
    AK128127 mRNA. Translation: BAC87285.1.
    AK289666 mRNA. Translation: BAF82355.1.
    AF493927 mRNA. Translation: AAM12641.1.
    AF493941 mRNA. Translation: AAM12655.1.
    AY585192 mRNA. Translation: AAT79495.1.
    AF463495 Genomic DNA. Translation: AAL68829.1.
    AL162727 Genomic DNA. Translation: CAC78977.1.
    AL162727, AL359455 Genomic DNA. Translation: CAH70841.1.
    AL162727, AL137066, AL359455 Genomic DNA. Translation: CAH70843.1.
    AL137066, AL162727, AL359455 Genomic DNA. Translation: CAH70102.1.
    AL137066, AL359455 Genomic DNA. Translation: CAH70103.1.
    AL359455, AL137066 Genomic DNA. Translation: CAH73880.1.
    AL359455, AL162727 Genomic DNA. Translation: CAH73877.1.
    AL359455, AL137066, AL162727 Genomic DNA. Translation: CAH73879.1.
    CH471090 Genomic DNA. Translation: EAW87388.1.
    CH471090 Genomic DNA. Translation: EAW87391.1.
    CH471090 Genomic DNA. Translation: EAW87393.1.
    BC019039 mRNA. Translation: AAH19039.3.
    BC042555 mRNA. Translation: AAH42555.1.
    CCDSiCCDS35113.1. [P49796-5]
    CCDS35114.1. [P49796-7]
    CCDS43869.1. [P49796-3]
    CCDS65111.1. [P49796-9]
    CCDS6797.1. [P49796-4]
    CCDS6798.1. [P49796-1]
    PIRiS78089.
    RefSeqiNP_001263189.1. NM_001276260.1. [P49796-1]
    NP_001263190.1. NM_001276261.1. [P49796-9]
    NP_001263191.1. NM_001276262.1.
    NP_001269851.1. NM_001282922.1. [P49796-1]
    NP_001269852.1. NM_001282923.1.
    NP_060260.3. NM_017790.4. [P49796-5]
    NP_570613.2. NM_130795.3. [P49796-4]
    NP_602299.1. NM_134427.2.
    NP_652759.3. NM_144488.5. [P49796-3]
    NP_652760.2. NM_144489.3. [P49796-7]
    XP_006717282.1. XM_006717219.1. [P49796-6]
    XP_006717289.1. XM_006717226.1. [P49796-1]
    XP_006717290.1. XM_006717227.1. [P49796-1]
    XP_006717291.1. XM_006717228.1. [P49796-1]
    XP_006717292.1. XM_006717229.1. [P49796-1]
    XP_006717293.1. XM_006717230.1. [P49796-1]
    UniGeneiHs.494875.

    Genome annotation databases

    EnsembliENST00000317613; ENSP00000312844; ENSG00000138835. [P49796-5]
    ENST00000343817; ENSP00000340284; ENSG00000138835. [P49796-4]
    ENST00000350696; ENSP00000259406; ENSG00000138835. [P49796-3]
    ENST00000374134; ENSP00000363249; ENSG00000138835. [P49796-1]
    ENST00000374140; ENSP00000363255; ENSG00000138835. [P49796-3]
    ENST00000394646; ENSP00000378141; ENSG00000138835. [P49796-9]
    ENST00000462143; ENSP00000420356; ENSG00000138835. [P49796-1]
    ENST00000462403; ENSP00000436168; ENSG00000138835. [P49796-7]
    GeneIDi5998.
    KEGGihsa:5998.
    UCSCiuc004bhq.4. human. [P49796-3]
    uc004bhr.4. human. [P49796-5]
    uc004bht.4. human. [P49796-4]
    uc004bhv.4. human. [P49796-1]
    uc004bia.4. human.

    Polymorphism databases

    DMDMi67477383.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U27655 mRNA. Translation: AAC50394.1 .
    AF490838 mRNA. Translation: AAM33253.1 .
    AF490839 mRNA. Translation: AAM33254.1 .
    AF490840 mRNA. Translation: AAM33255.1 .
    AK074977 mRNA. Translation: BAC11328.1 .
    AK096840 mRNA. Translation: BAG53374.1 .
    AK128127 mRNA. Translation: BAC87285.1 .
    AK289666 mRNA. Translation: BAF82355.1 .
    AF493927 mRNA. Translation: AAM12641.1 .
    AF493941 mRNA. Translation: AAM12655.1 .
    AY585192 mRNA. Translation: AAT79495.1 .
    AF463495 Genomic DNA. Translation: AAL68829.1 .
    AL162727 Genomic DNA. Translation: CAC78977.1 .
    AL162727 , AL359455 Genomic DNA. Translation: CAH70841.1 .
    AL162727 , AL137066 , AL359455 Genomic DNA. Translation: CAH70843.1 .
    AL137066 , AL162727 , AL359455 Genomic DNA. Translation: CAH70102.1 .
    AL137066 , AL359455 Genomic DNA. Translation: CAH70103.1 .
    AL359455 , AL137066 Genomic DNA. Translation: CAH73880.1 .
    AL359455 , AL162727 Genomic DNA. Translation: CAH73877.1 .
    AL359455 , AL137066 , AL162727 Genomic DNA. Translation: CAH73879.1 .
    CH471090 Genomic DNA. Translation: EAW87388.1 .
    CH471090 Genomic DNA. Translation: EAW87391.1 .
    CH471090 Genomic DNA. Translation: EAW87393.1 .
    BC019039 mRNA. Translation: AAH19039.3 .
    BC042555 mRNA. Translation: AAH42555.1 .
    CCDSi CCDS35113.1. [P49796-5 ]
    CCDS35114.1. [P49796-7 ]
    CCDS43869.1. [P49796-3 ]
    CCDS65111.1. [P49796-9 ]
    CCDS6797.1. [P49796-4 ]
    CCDS6798.1. [P49796-1 ]
    PIRi S78089.
    RefSeqi NP_001263189.1. NM_001276260.1. [P49796-1 ]
    NP_001263190.1. NM_001276261.1. [P49796-9 ]
    NP_001263191.1. NM_001276262.1.
    NP_001269851.1. NM_001282922.1. [P49796-1 ]
    NP_001269852.1. NM_001282923.1.
    NP_060260.3. NM_017790.4. [P49796-5 ]
    NP_570613.2. NM_130795.3. [P49796-4 ]
    NP_602299.1. NM_134427.2.
    NP_652759.3. NM_144488.5. [P49796-3 ]
    NP_652760.2. NM_144489.3. [P49796-7 ]
    XP_006717282.1. XM_006717219.1. [P49796-6 ]
    XP_006717289.1. XM_006717226.1. [P49796-1 ]
    XP_006717290.1. XM_006717227.1. [P49796-1 ]
    XP_006717291.1. XM_006717228.1. [P49796-1 ]
    XP_006717292.1. XM_006717229.1. [P49796-1 ]
    XP_006717293.1. XM_006717230.1. [P49796-1 ]
    UniGenei Hs.494875.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2F5Y X-ray 2.39 A/B 300-384 [» ]
    2OJ4 X-ray 2.30 A 1064-1190 [» ]
    3FBK X-ray 2.00 A/B 134-276 [» ]
    ProteinModelPortali P49796.
    SMRi P49796. Positions 136-275, 299-376, 1064-1190.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111930. 15 interactions.
    IntActi P49796. 16 interactions.
    MINTi MINT-136831.

    PTM databases

    PhosphoSitei P49796.

    Polymorphism databases

    DMDMi 67477383.

    Proteomic databases

    MaxQBi P49796.
    PaxDbi P49796.
    PRIDEi P49796.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000317613 ; ENSP00000312844 ; ENSG00000138835 . [P49796-5 ]
    ENST00000343817 ; ENSP00000340284 ; ENSG00000138835 . [P49796-4 ]
    ENST00000350696 ; ENSP00000259406 ; ENSG00000138835 . [P49796-3 ]
    ENST00000374134 ; ENSP00000363249 ; ENSG00000138835 . [P49796-1 ]
    ENST00000374140 ; ENSP00000363255 ; ENSG00000138835 . [P49796-3 ]
    ENST00000394646 ; ENSP00000378141 ; ENSG00000138835 . [P49796-9 ]
    ENST00000462143 ; ENSP00000420356 ; ENSG00000138835 . [P49796-1 ]
    ENST00000462403 ; ENSP00000436168 ; ENSG00000138835 . [P49796-7 ]
    GeneIDi 5998.
    KEGGi hsa:5998.
    UCSCi uc004bhq.4. human. [P49796-3 ]
    uc004bhr.4. human. [P49796-5 ]
    uc004bht.4. human. [P49796-4 ]
    uc004bhv.4. human. [P49796-1 ]
    uc004bia.4. human.

    Organism-specific databases

    CTDi 5998.
    GeneCardsi GC09P116207.
    HGNCi HGNC:9999. RGS3.
    HPAi CAB032507.
    MIMi 602189. gene.
    neXtProti NX_P49796.
    PharmGKBi PA34374.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG266213.
    HOVERGENi HBG013233.
    InParanoidi P49796.
    KOi K07524.
    OMAi QEPRGPC.
    OrthoDBi EOG7VHSZ5.
    PhylomeDBi P49796.
    TreeFami TF351952.

    Miscellaneous databases

    ChiTaRSi RGS3. human.
    EvolutionaryTracei P49796.
    GeneWikii RGS3.
    GenomeRNAii 5998.
    NextBioi 23375.
    PROi P49796.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P49796.
    Bgeei P49796.
    Genevestigatori P49796.

    Family and domain databases

    Gene3Di 1.10.196.10. 2 hits.
    2.30.29.30. 1 hit.
    2.30.42.10. 1 hit.
    2.60.40.150. 1 hit.
    InterProi IPR000008. C2_dom.
    IPR001478. PDZ.
    IPR011993. PH_like_dom.
    IPR024066. Regulat_G_prot_signal_dom1.
    IPR016137. Regulat_G_prot_signal_superfam.
    IPR000342. RGS_dom.
    [Graphical view ]
    Pfami PF00168. C2. 1 hit.
    PF00595. PDZ. 1 hit.
    PF00615. RGS. 1 hit.
    [Graphical view ]
    PRINTSi PR01301. RGSPROTEIN.
    SMARTi SM00239. C2. 1 hit.
    SM00228. PDZ. 1 hit.
    SM00315. RGS. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48097. SSF48097. 1 hit.
    SSF49562. SSF49562. 1 hit.
    SSF50156. SSF50156. 1 hit.
    PROSITEi PS50004. C2. 1 hit.
    PS50106. PDZ. 1 hit.
    PS50132. RGS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Inhibition of G-protein-mediated MAP kinase activation by a new mammalian gene family."
      Druey K.M., Blumer K.J., Kang V.H., Kehrl J.H.
      Nature 379:742-746(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
    2. "Additional 5' exons in the RGS3 locus generate multiple mRNA transcripts, one of which accounts for the origin of human PDZ-RGS3."
      Kehrl J.H., Srikumar D., Harrison K., Wilson G.L., Shi C.S.
      Genomics 79:860-868(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4; 6 AND 8), NUCLEOTIDE SEQUENCE [MRNA] OF 105-1198 (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 5 AND 9).
      Tissue: Amygdala and Testis.
    4. "Human PDZ-RGS3."
      Chatterjee T.K., Fisher R.A.
      Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 4).
    5. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
      Puhl H.L. III, Ikeda S.R., Aronstam R.S.
      Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain.
    6. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
      Tissue: Brain and Kidney.
    9. "RGS3 inhibits G protein-mediated signaling via translocation to the membrane and binding to Galpha11."
      Dulin N.O., Sorokin A., Reed E., Elliott S., Kehrl J.H., Dunn M.J.
      Mol. Cell. Biol. 19:714-723(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH GNA11 AND GNA13, SUBCELLULAR LOCATION.
    10. "Regulator of G protein signaling RGS3T is localized to the nucleus and induces apoptosis."
      Dulin N.O., Pratt P., Tiruppathi C., Niu J., Voyno-Yasenetskaya T., Dunn M.J.
      J. Biol. Chem. 275:21317-21323(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION.
    11. "Regulator of G-protein signaling 3 (RGS3) inhibits G-beta1/gamma2-induced inositol phosphate production, mitogen-activated protein kinase activation, and Akt activation."
      Shi C.-S., Lee S.B., Sinnarajah S., Dessauer C.W., Rhee S.G., Kehrl J.H.
      J. Biol. Chem. 276:24293-24300(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH HETERODIMERIC GNB1-GNG2, SUBCELLULAR LOCATION.
    12. "Identification and Herc5-mediated ISGylation of novel target proteins."
      Takeuchi T., Inoue S., Yokosawa H.
      Biochem. Biophys. Res. Commun. 348:473-477(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: ISGYLATION.
    13. "Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line."
      Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S.
      Electrophoresis 28:2027-2034(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Prostate cancer.

    Entry informationi

    Entry nameiRGS3_HUMAN
    AccessioniPrimary (citable) accession number: P49796
    Secondary accession number(s): A6NHA0
    , A8K0V1, B3KUB2, Q5VXB8, Q5VXC1, Q5VZ05, Q5VZ06, Q6ZRM5, Q8IUQ1, Q8NC47, Q8NFN4, Q8NFN5, Q8NFN6, Q8TD59, Q8TD68, Q8WV02, Q8WXA0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: June 7, 2005
    Last modified: October 1, 2014
    This is version 154 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3