Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Regulator of G-protein signaling 3

Gene

RGS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.4 Publications

GO - Molecular functioni

  • GTPase activator activity Source: ProtInc

GO - Biological processi

  • inactivation of MAPK activity Source: ProtInc
  • regulation of G-protein coupled receptor protein signaling pathway Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Signal transduction inhibitor

Enzyme and pathway databases

BioCyciZFISH:ENSG00000138835-MONOMER.
ReactomeiR-HSA-416476. G alpha (q) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Regulator of G-protein signaling 3
Short name:
RGP3
Short name:
RGS3
Gene namesi
Name:RGS3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:9999. RGS3.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • cytosol Source: ProtInc
  • nucleoplasm Source: HPA
  • plasma membrane Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi5998.
OpenTargetsiENSG00000138835.
PharmGKBiPA34374.

Polymorphism and mutation databases

DMDMi67477383.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002041821 – 1198Regulator of G-protein signaling 3Add BLAST1198

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei448Omega-N-methylarginineCombined sources1
Modified residuei674PhosphoserineCombined sources1
Modified residuei943PhosphoserineCombined sources1
Modified residuei946PhosphoserineBy similarity1
Modified residuei978PhosphoserineBy similarity1
Modified residuei1007PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by cyclic GMP-dependent protein kinase.By similarity
ISGylated.1 Publication

Keywords - PTMi

Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP49796.
PaxDbiP49796.
PeptideAtlasiP49796.
PRIDEiP49796.

PTM databases

iPTMnetiP49796.
PhosphoSitePlusiP49796.
SwissPalmiP49796.

Expressioni

Gene expression databases

BgeeiENSG00000138835.
ExpressionAtlasiP49796. baseline and differential.
GenevisibleiP49796. HS.

Organism-specific databases

HPAiCAB032507.
HPA041109.

Interactioni

Subunit structurei

Binds EFNB1 and EFNB2 (By similarity). Binds the GNB1-GNG2 heterodimer.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
ACDQ96AP02EBI-2107809,EBI-717666
GORASP2Q9H8Y83EBI-10211517,EBI-739467
PLSCR1O151623EBI-2107809,EBI-740019

Protein-protein interaction databases

BioGridi111930. 48 interactors.
IntActiP49796. 19 interactors.
MINTiMINT-136831.
STRINGi9606.ENSP00000259406.

Structurei

Secondary structure

11198
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi140 – 161Combined sources22
Beta strandi166 – 168Combined sources3
Beta strandi172 – 180Combined sources9
Beta strandi200 – 208Combined sources9
Helixi211 – 213Combined sources3
Beta strandi216 – 224Combined sources9
Helixi229 – 231Combined sources3
Beta strandi233 – 241Combined sources9
Helixi242 – 245Combined sources4
Beta strandi252 – 257Combined sources6
Helixi263 – 265Combined sources3
Beta strandi300 – 303Combined sources4
Beta strandi310 – 314Combined sources5
Beta strandi316 – 318Combined sources3
Beta strandi320 – 324Combined sources5
Helixi329 – 333Combined sources5
Beta strandi340 – 344Combined sources5
Helixi354 – 362Combined sources9
Beta strandi365 – 374Combined sources10
Helixi1066 – 1070Combined sources5
Helixi1074 – 1078Combined sources5
Helixi1081 – 1093Combined sources13
Helixi1097 – 1109Combined sources13
Helixi1115 – 1129Combined sources15
Helixi1142 – 1150Combined sources9
Turni1157 – 1160Combined sources4
Helixi1161 – 1173Combined sources13
Helixi1175 – 1181Combined sources7
Helixi1183 – 1186Combined sources4
Turni1187 – 1189Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2F5YX-ray2.39A/B300-384[»]
2OJ4X-ray2.30A1064-1190[»]
3FBKX-ray2.00A/B134-276[»]
ProteinModelPortaliP49796.
SMRiP49796.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP49796.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini137 – 239C2PROSITE-ProRule annotationAdd BLAST103
Domaini299 – 376PDZPROSITE-ProRule annotationAdd BLAST78
Domaini1073 – 1198RGSPROSITE-ProRule annotationAdd BLAST126

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi705 – 819Pro-richAdd BLAST115

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 RGS domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3589. Eukaryota.
ENOG410YMJD. LUCA.
GeneTreeiENSGT00760000118903.
HOGENOMiHOG000139935.
HOVERGENiHBG013233.
InParanoidiP49796.
KOiK07524.
OMAiQPAGKAD.
OrthoDBiEOG091G0BDG.
PhylomeDBiP49796.
TreeFamiTF351952.

Family and domain databases

Gene3Di1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
IPR001478. PDZ.
IPR011993. PH_dom-like.
IPR016137. RGS.
IPR024066. RGS_subdom1.
[Graphical view]
PfamiPF00168. C2. 1 hit.
PF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSiPR01301. RGSPROTEIN.
SMARTiSM00239. C2. 1 hit.
SM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF48097. SSF48097. 1 hit.
SSF49562. SSF49562. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: P49796-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVIPALWEV EMGRSQGQEI ETILANRSHS DSTPLPNFLS GSHRPECCTC
60 70 80 90 100
RLLTASGAQD SLPFGRRLYS GPWRSCEEVC HVSVLSVLST SCGLSLSLPI
110 120 130 140 150
FPGWMEWLSP DIALPRRDEW TQTSPARKRI THAKVQGAGQ LRLSIDAQDR
160 170 180 190 200
VLLLHIIEGK GLISKQPGTC DPYVKISLIP EDSRLRHQKT QTVPDCRDPA
210 220 230 240 250
FHEHFFFPVQ EEDDQKRLLV TVWNRASQSR QSGLIGCMSF GVKSLLTPDK
260 270 280 290 300
EISGWYYLLG EHLGRTKHLK VARRRLRPLR DPLLRMPGGG DTENGKKLKI
310 320 330 340 350
TIPRGKDGFG FTICCDSPVR VQAVDSGGPA ERAGLQQLDT VLQLNERPVE
360 370 380 390 400
HWKCVELAHE IRSCPSEIIL LVWRMVPQVK PGPDGGVLRR ASCKSTHDLQ
410 420 430 440 450
SPPNKREKNC THGVQARPEQ RHSCHLVCDS SDGLLLGGWE RYTEVAKRGG
460 470 480 490 500
QHTLPALSRA TAPTDPNYII LAPLNPGSQL LRPVYQEDTI PEESGSPSKG
510 520 530 540 550
KSYTGLGKKS RLMKTVQTMK GHGNYQNCPV VRPHATHSSY GTYVTLAPKV
560 570 580 590 600
LVFPVFVQPL DLCNPARTLL LSEELLLYEG RNKAAEVTLF AYSDLLLFTK
610 620 630 640 650
EDEPGRCDVL RNPLYLQSVK LQEGSSEDLK FCVLYLAEKA ECLFTLEAHS
660 670 680 690 700
QEQKKRVCWC LSENIAKQQQ LAASPPDSKM FETEADEKRE MALEEGKGPG
710 720 730 740 750
AEDSPPSKEP SPGQELPPGQ DLPPNKDSPS GQEPAPSQEP LSSKDSATSE
760 770 780 790 800
GSPPGPDAPP SKDVPPCQEP PPAQDLSPCQ DLPAGQEPLP HQDPLLTKDL
810 820 830 840 850
PAIQESPTRD LPPCQDLPPS QVSLPAKALT EDTMSSGDLL AATGDPPAAP
860 870 880 890 900
RPAFVIPEVR LDSTYSQKAG AEQGCSGDEE DAEEAEEVEE GEEGEEDEDE
910 920 930 940 950
DTSDDNYGER SEAKRSSMIE TGQGAEGGLS LRVQNSLRRR THSEGSLLQE
960 970 980 990 1000
PRGPCFASDT TLHCSDGEGA ASTWGMPSPS TLKKELGRNG GSMHHLSLFF
1010 1020 1030 1040 1050
TGHRKMSGAD TVGDDDEASR KRKSKNLAKD MKNKLGIFRR RNESPGAPPA
1060 1070 1080 1090 1100
GKADKMMKSF KPTSEEALKW GESLEKLLVH KYGLAVFQAF LRTEFSEENL
1110 1120 1130 1140 1150
EFWLACEDFK KVKSQSKMAS KAKKIFAEYI AIQACKEVNL DSYTREHTKD
1160 1170 1180 1190
NLQSVTRGCF DLAQKRIFGL MEKDSYPRFL RSDLYLDLIN QKKMSPPL
Length:1,198
Mass (Da):132,336
Last modified:June 7, 2005 - v2
Checksum:iE615DA49022EFFE4
GO
Isoform 1 (identifier: P49796-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-679: Missing.

Show »
Length:519
Mass (Da):56,602
Checksum:iF1CFE3F27D4673A0
GO
Isoform 2 (identifier: P49796-2) [UniParc]FASTAAdd to basket
Also known as: RGS3T

The sequence of this isoform differs from the canonical sequence as follows:
     1-992: Missing.

Note: Nuclear.1 Publication
Show »
Length:206
Mass (Da):23,725
Checksum:iE24047B4952692D4
GO
Isoform 4 (identifier: P49796-4) [UniParc]FASTAAdd to basket
Also known as: 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-281: Missing.
     282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ

Show »
Length:917
Mass (Da):100,948
Checksum:i17D77BE23D0A1C52
GO
Isoform 5 (identifier: P49796-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-112: Missing.
     113-138: ALPRRDEWTQTSPARKRITHAKVQGA → MERSLHRVSLGSRRAHPDLSFYLTTF
     680-714: MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQ → KLHPFGSLQQEMGPVNSTNATQDRSFTSPGQTLIG
     715-1198: Missing.

Show »
Length:602
Mass (Da):67,282
Checksum:i1976A77C3FC3933F
GO
Isoform 6 (identifier: P49796-6) [UniParc]FASTAAdd to basket
Also known as: C2PA-RGS3

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.

Show »
Length:1,094
Mass (Da):121,008
Checksum:i9465608DAA6F95B6
GO
Isoform 7 (identifier: P49796-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE

Note: No experimental confirmation available.
Show »
Length:311
Mass (Da):35,108
Checksum:i6886A35CF3ADF13E
GO
Isoform 8 (identifier: P49796-8) [UniParc]FASTAAdd to basket
Also known as: RGS3S

The sequence of this isoform differs from the canonical sequence as follows:
     1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE
     1198-1198: L → LDYKDDDDK

Show »
Length:319
Mass (Da):36,103
Checksum:iB667E606719743CF
GO
Isoform 9 (identifier: P49796-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-281: Missing.
     282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ
     679-1004: Missing.

Note: No experimental confirmation available.
Show »
Length:591
Mass (Da):66,478
Checksum:i379E2AA9DB27D837
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti170C → W in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti206F → S in BAC11328 (PubMed:14702039).Curated1
Sequence conflicti266T → A in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti462A → V in AAL68829 (Ref. 4) Curated1
Sequence conflicti585A → V in AAM33255 (PubMed:12036301).Curated1
Sequence conflicti632C → R in BAC11328 (PubMed:14702039).Curated1
Sequence conflicti705Missing in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti725N → S in AAH42555 (PubMed:15489334).Curated1
Sequence conflicti873Q → H in AAM33254 (PubMed:12036301).Curated1
Sequence conflicti883 – 884EE → KQ in AAM33254 (PubMed:12036301).Curated2
Sequence conflicti984K → R in AAM12641 (Ref. 5) Curated1
Sequence conflicti1127A → V in AAM33253 (PubMed:12036301).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051794129R → K.Corresponds to variant rs16933949dbSNPEnsembl.1
Natural variantiVAR_061769809R → Q.Corresponds to variant rs41305473dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0470291 – 1027MPVIP…KSKNL → MVTRRPVTNSWDWLPAGAAP EAVPCRHMPLSRLPLRVGQK EFFFPLPLLVPPISWLLLSE SQPRLVPGSPVIRPGFQRAC VAAACTVAARCPGRGVGDRS QSGASYRPICGPKVGGPTEM LRGMYLTRNGNLQRRHTMKE in isoform 7 and isoform 8. 1 PublicationAdd BLAST1027
Alternative sequenceiVSP_0056621 – 992Missing in isoform 2. 1 PublicationAdd BLAST992
Alternative sequenceiVSP_0139581 – 679Missing in isoform 1. 4 PublicationsAdd BLAST679
Alternative sequenceiVSP_0139591 – 281Missing in isoform 4 and isoform 9. 5 PublicationsAdd BLAST281
Alternative sequenceiVSP_0139611 – 112Missing in isoform 5. 1 PublicationAdd BLAST112
Alternative sequenceiVSP_0139601 – 104Missing in isoform 6. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_013962113 – 138ALPRR…KVQGA → MERSLHRVSLGSRRAHPDLS FYLTTF in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_013963282 – 299PLLRM…GKKLK → MNRFNGLCKVCSERRYRQ in isoform 4 and isoform 9. 5 PublicationsAdd BLAST18
Alternative sequenceiVSP_054690679 – 1004Missing in isoform 9. 1 PublicationAdd BLAST326
Alternative sequenceiVSP_013964680 – 714MFETE…PSPGQ → KLHPFGSLQQEMGPVNSTNA TQDRSFTSPGQTLIG in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_013965715 – 1198Missing in isoform 5. 1 PublicationAdd BLAST484
Alternative sequenceiVSP_0535331198L → LDYKDDDDK in isoform 8. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U27655 mRNA. Translation: AAC50394.1.
AF490838 mRNA. Translation: AAM33253.1.
AF490839 mRNA. Translation: AAM33254.1.
AF490840 mRNA. Translation: AAM33255.1.
AK074977 mRNA. Translation: BAC11328.1.
AK096840 mRNA. Translation: BAG53374.1.
AK128127 mRNA. Translation: BAC87285.1.
AK289666 mRNA. Translation: BAF82355.1.
AF493927 mRNA. Translation: AAM12641.1.
AF493941 mRNA. Translation: AAM12655.1.
AY585192 mRNA. Translation: AAT79495.1.
AF463495 Genomic DNA. Translation: AAL68829.1.
AL162727 Genomic DNA. Translation: CAC78977.1.
AL162727, AL359455 Genomic DNA. Translation: CAH70841.1.
AL162727, AL137066, AL359455 Genomic DNA. Translation: CAH70843.1.
AL137066, AL162727, AL359455 Genomic DNA. Translation: CAH70102.1.
AL137066, AL359455 Genomic DNA. Translation: CAH70103.1.
AL359455, AL137066 Genomic DNA. Translation: CAH73880.1.
AL359455, AL162727 Genomic DNA. Translation: CAH73877.1.
AL359455, AL137066, AL162727 Genomic DNA. Translation: CAH73879.1.
CH471090 Genomic DNA. Translation: EAW87388.1.
CH471090 Genomic DNA. Translation: EAW87391.1.
CH471090 Genomic DNA. Translation: EAW87393.1.
BC019039 mRNA. Translation: AAH19039.3.
BC042555 mRNA. Translation: AAH42555.1.
CCDSiCCDS35113.1. [P49796-5]
CCDS35114.1. [P49796-7]
CCDS43869.1. [P49796-3]
CCDS65111.1. [P49796-9]
CCDS6797.1. [P49796-4]
CCDS6798.1. [P49796-1]
PIRiS78089.
RefSeqiNP_001263189.1. NM_001276260.1. [P49796-1]
NP_001263190.1. NM_001276261.1. [P49796-9]
NP_001263191.1. NM_001276262.1.
NP_001269851.1. NM_001282922.1. [P49796-1]
NP_001269852.1. NM_001282923.1.
NP_060260.3. NM_017790.4. [P49796-5]
NP_570613.2. NM_130795.3. [P49796-4]
NP_602299.1. NM_134427.2.
NP_652759.3. NM_144488.5. [P49796-3]
NP_652760.2. NM_144489.3. [P49796-7]
XP_006717282.1. XM_006717219.2. [P49796-6]
XP_006717289.1. XM_006717226.2. [P49796-1]
XP_006717293.1. XM_006717230.3. [P49796-1]
XP_011517198.1. XM_011518896.1. [P49796-1]
XP_011517199.1. XM_011518897.2. [P49796-1]
XP_011517200.1. XM_011518898.1. [P49796-1]
XP_011517202.1. XM_011518900.1. [P49796-1]
XP_011517203.1. XM_011518901.1. [P49796-1]
XP_016870494.1. XM_017015005.1. [P49796-1]
XP_016870495.1. XM_017015006.1. [P49796-1]
UniGeneiHs.494875.
Hs.655276.

Genome annotation databases

EnsembliENST00000317613; ENSP00000312844; ENSG00000138835. [P49796-5]
ENST00000343817; ENSP00000340284; ENSG00000138835. [P49796-4]
ENST00000350696; ENSP00000259406; ENSG00000138835. [P49796-3]
ENST00000374134; ENSP00000363249; ENSG00000138835. [P49796-1]
ENST00000374140; ENSP00000363255; ENSG00000138835. [P49796-3]
ENST00000394646; ENSP00000378141; ENSG00000138835. [P49796-9]
ENST00000462143; ENSP00000420356; ENSG00000138835. [P49796-1]
ENST00000462403; ENSP00000436168; ENSG00000138835. [P49796-7]
ENST00000613049; ENSP00000482612; ENSG00000138835. [P49796-7]
GeneIDi5998.
KEGGihsa:5998.
UCSCiuc004bhq.5. human. [P49796-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U27655 mRNA. Translation: AAC50394.1.
AF490838 mRNA. Translation: AAM33253.1.
AF490839 mRNA. Translation: AAM33254.1.
AF490840 mRNA. Translation: AAM33255.1.
AK074977 mRNA. Translation: BAC11328.1.
AK096840 mRNA. Translation: BAG53374.1.
AK128127 mRNA. Translation: BAC87285.1.
AK289666 mRNA. Translation: BAF82355.1.
AF493927 mRNA. Translation: AAM12641.1.
AF493941 mRNA. Translation: AAM12655.1.
AY585192 mRNA. Translation: AAT79495.1.
AF463495 Genomic DNA. Translation: AAL68829.1.
AL162727 Genomic DNA. Translation: CAC78977.1.
AL162727, AL359455 Genomic DNA. Translation: CAH70841.1.
AL162727, AL137066, AL359455 Genomic DNA. Translation: CAH70843.1.
AL137066, AL162727, AL359455 Genomic DNA. Translation: CAH70102.1.
AL137066, AL359455 Genomic DNA. Translation: CAH70103.1.
AL359455, AL137066 Genomic DNA. Translation: CAH73880.1.
AL359455, AL162727 Genomic DNA. Translation: CAH73877.1.
AL359455, AL137066, AL162727 Genomic DNA. Translation: CAH73879.1.
CH471090 Genomic DNA. Translation: EAW87388.1.
CH471090 Genomic DNA. Translation: EAW87391.1.
CH471090 Genomic DNA. Translation: EAW87393.1.
BC019039 mRNA. Translation: AAH19039.3.
BC042555 mRNA. Translation: AAH42555.1.
CCDSiCCDS35113.1. [P49796-5]
CCDS35114.1. [P49796-7]
CCDS43869.1. [P49796-3]
CCDS65111.1. [P49796-9]
CCDS6797.1. [P49796-4]
CCDS6798.1. [P49796-1]
PIRiS78089.
RefSeqiNP_001263189.1. NM_001276260.1. [P49796-1]
NP_001263190.1. NM_001276261.1. [P49796-9]
NP_001263191.1. NM_001276262.1.
NP_001269851.1. NM_001282922.1. [P49796-1]
NP_001269852.1. NM_001282923.1.
NP_060260.3. NM_017790.4. [P49796-5]
NP_570613.2. NM_130795.3. [P49796-4]
NP_602299.1. NM_134427.2.
NP_652759.3. NM_144488.5. [P49796-3]
NP_652760.2. NM_144489.3. [P49796-7]
XP_006717282.1. XM_006717219.2. [P49796-6]
XP_006717289.1. XM_006717226.2. [P49796-1]
XP_006717293.1. XM_006717230.3. [P49796-1]
XP_011517198.1. XM_011518896.1. [P49796-1]
XP_011517199.1. XM_011518897.2. [P49796-1]
XP_011517200.1. XM_011518898.1. [P49796-1]
XP_011517202.1. XM_011518900.1. [P49796-1]
XP_011517203.1. XM_011518901.1. [P49796-1]
XP_016870494.1. XM_017015005.1. [P49796-1]
XP_016870495.1. XM_017015006.1. [P49796-1]
UniGeneiHs.494875.
Hs.655276.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2F5YX-ray2.39A/B300-384[»]
2OJ4X-ray2.30A1064-1190[»]
3FBKX-ray2.00A/B134-276[»]
ProteinModelPortaliP49796.
SMRiP49796.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111930. 48 interactors.
IntActiP49796. 19 interactors.
MINTiMINT-136831.
STRINGi9606.ENSP00000259406.

PTM databases

iPTMnetiP49796.
PhosphoSitePlusiP49796.
SwissPalmiP49796.

Polymorphism and mutation databases

DMDMi67477383.

Proteomic databases

EPDiP49796.
PaxDbiP49796.
PeptideAtlasiP49796.
PRIDEiP49796.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317613; ENSP00000312844; ENSG00000138835. [P49796-5]
ENST00000343817; ENSP00000340284; ENSG00000138835. [P49796-4]
ENST00000350696; ENSP00000259406; ENSG00000138835. [P49796-3]
ENST00000374134; ENSP00000363249; ENSG00000138835. [P49796-1]
ENST00000374140; ENSP00000363255; ENSG00000138835. [P49796-3]
ENST00000394646; ENSP00000378141; ENSG00000138835. [P49796-9]
ENST00000462143; ENSP00000420356; ENSG00000138835. [P49796-1]
ENST00000462403; ENSP00000436168; ENSG00000138835. [P49796-7]
ENST00000613049; ENSP00000482612; ENSG00000138835. [P49796-7]
GeneIDi5998.
KEGGihsa:5998.
UCSCiuc004bhq.5. human. [P49796-3]

Organism-specific databases

CTDi5998.
DisGeNETi5998.
GeneCardsiRGS3.
HGNCiHGNC:9999. RGS3.
HPAiCAB032507.
HPA041109.
MIMi602189. gene.
neXtProtiNX_P49796.
OpenTargetsiENSG00000138835.
PharmGKBiPA34374.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3589. Eukaryota.
ENOG410YMJD. LUCA.
GeneTreeiENSGT00760000118903.
HOGENOMiHOG000139935.
HOVERGENiHBG013233.
InParanoidiP49796.
KOiK07524.
OMAiQPAGKAD.
OrthoDBiEOG091G0BDG.
PhylomeDBiP49796.
TreeFamiTF351952.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000138835-MONOMER.
ReactomeiR-HSA-416476. G alpha (q) signalling events.

Miscellaneous databases

ChiTaRSiRGS3. human.
EvolutionaryTraceiP49796.
GeneWikiiRGS3.
GenomeRNAii5998.
PROiP49796.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138835.
ExpressionAtlasiP49796. baseline and differential.
GenevisibleiP49796. HS.

Family and domain databases

Gene3Di1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
IPR001478. PDZ.
IPR011993. PH_dom-like.
IPR016137. RGS.
IPR024066. RGS_subdom1.
[Graphical view]
PfamiPF00168. C2. 1 hit.
PF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSiPR01301. RGSPROTEIN.
SMARTiSM00239. C2. 1 hit.
SM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF48097. SSF48097. 1 hit.
SSF49562. SSF49562. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRGS3_HUMAN
AccessioniPrimary (citable) accession number: P49796
Secondary accession number(s): A6NHA0
, A8K0V1, B3KUB2, Q5VXB8, Q5VXC1, Q5VZ05, Q5VZ06, Q6ZRM5, Q8IUQ1, Q8NC47, Q8NFN4, Q8NFN5, Q8NFN6, Q8TD59, Q8TD68, Q8WV02, Q8WXA0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: June 7, 2005
Last modified: November 30, 2016
This is version 177 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.