P49796 (RGS3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 139.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Regulator of G-protein signaling 3 Short name=RGP3 Short name=RGS3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1198 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases. Ref.1 Ref.9 Ref.10 Ref.11 |
| Subunit structure | Binds EFNB1 and EFNB2 By similarity. Binds the GNB1-GNG2 heterodimer. |
| Subcellular location | Cytoplasm. Nucleus. Cell membrane; Peripheral membrane protein Potential. Note: Long isoforms are cytoplasmic and associated with the plasma membrane. Short isoforms are nuclear. Ref.9 Ref.10 Ref.11 |
| Post-translational modification | Phosphorylated by cyclic GMP-dependent protein kinase By similarity. ISGylated Probable. Ref.12 |
| Sequence similarities | Contains 1 C2 domain. Contains 1 PDZ (DHR) domain. Contains 1 RGS domain. |
| Sequence caution | The sequence AAM33254.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Cytoplasm Membrane Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Signal transduction inhibitor |
| PTM | Phosphoprotein Ubl conjugation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | inactivation of MAPK activity Traceable author statement Ref.1. Source: ProtInc regulation of G-protein coupled receptor protein signaling pathwayTraceable author statement Ref.9. Source: ProtInc termination of G-protein coupled receptor signaling pathwayInferred from electronic annotation. Source: InterPro |
| Cellular_component | cytosol Traceable author statement Ref.9. Source: ProtInc nucleusInferred from electronic annotation. Source: UniProtKB-SubCell plasma membraneInferred from Biological aspect of Ancestor. Source: RefGenome |
| Molecular_function | GTPase activator activity Inferred from Biological aspect of Ancestor. Source: RefGenome |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3 (identifier: P49796-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P49796-1) The sequence of this isoform differs from the canonical sequence as follows: 1-679: Missing. | ||||||
| Isoform 2 (identifier: P49796-2) Also known as: RGS3T; The sequence of this isoform differs from the canonical sequence as follows: 1-992: Missing. | ||||||
| Note: Nuclear. | ||||||
| Isoform 4 (identifier: P49796-4) Also known as: 1; The sequence of this isoform differs from the canonical sequence as follows: 1-281: Missing. 282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ | ||||||
| Isoform 5 (identifier: P49796-5) The sequence of this isoform differs from the canonical sequence as follows: 1-112: Missing. 113-138: ALPRRDEWTQTSPARKRITHAKVQGA → MERSLHRVSLGSRRAHPDLSFYLTTF 680-714: MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQ → KLHPFGSLQQEMGPVNSTNATQDRSFTSPGQTLIG 715-1198: Missing. | ||||||
| Isoform 6 (identifier: P49796-6) Also known as: C2PA-RGS3; The sequence of this isoform differs from the canonical sequence as follows: 1-104: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1198 | 1198 | Regulator of G-protein signaling 3 | PRO_0000204182 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 137 – 239 | 103 | C2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 299 – 376 | 78 | PDZ | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1073 – 1198 | 126 | RGS | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 705 – 819 | 115 | Pro-rich | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 943 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 946 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 992 | 992 | Missing in isoform 2. | VSP_005662 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 679 | 679 | Missing in isoform 1. | VSP_013958 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 281 | 281 | Missing in isoform 4. | VSP_013959 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 112 | 112 | Missing in isoform 5. | VSP_013961 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 104 | 104 | Missing in isoform 6. | VSP_013960 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 113 – 138 | 26 | ALPRR…KVQGA → MERSLHRVSLGSRRAHPDLS FYLTTF in isoform 5. | VSP_013962 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 282 – 299 | 18 | PLLRM…GKKLK → MNRFNGLCKVCSERRYRQ in isoform 4. | VSP_013963 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 680 – 714 | 35 | MFETE…PSPGQ → KLHPFGSLQQEMGPVNSTNA TQDRSFTSPGQTLIG in isoform 5. | VSP_013964 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 715 – 1198 | 484 | Missing in isoform 5. | VSP_013965 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 129 | 1 | R → K. Corresponds to variant rs16933949 [ dbSNP | Ensembl ]. | VAR_051794 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 809 | 1 | R → Q. Corresponds to variant rs41305473 [ dbSNP | Ensembl ]. | VAR_061769 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 170 | 1 | C → W in AAM33254. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 206 | 1 | F → S in BAC11328. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 266 | 1 | T → A in AAM33254. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 462 | 1 | A → V in AAL68829. Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 585 | 1 | A → V in AAM33255. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 632 | 1 | C → R in BAC11328. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 705 | 1 | Missing in AAM33254. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 725 | 1 | N → S in AAH42555. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 873 | 1 | Q → H in AAM33254. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 883 – 884 | 2 | EE → KQ in AAM33254. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 984 | 1 | K → R in AAM12641. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 140 – 161 | 22 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 166 – 168 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 172 – 180 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 200 – 208 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 211 – 213 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 216 – 224 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 229 – 231 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 233 – 241 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 242 – 245 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 252 – 257 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 263 – 265 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 300 – 303 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 310 – 314 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 316 – 318 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 320 – 324 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 329 – 333 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 340 – 344 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 354 – 362 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 365 – 374 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1066 – 1070 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1074 – 1078 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1081 – 1093 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1097 – 1109 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1115 – 1129 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1142 – 1150 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1157 – 1160 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1161 – 1173 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1175 – 1181 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1183 – 1186 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1187 – 1189 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Inhibition of G-protein-mediated MAP kinase activation by a new mammalian gene family." Druey K.M., Blumer K.J., Kang V.H., Kehrl J.H. Nature 379:742-746(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. |
| [2] | "Additional 5' exons in the RGS3 locus generate multiple mRNA transcripts, one of which accounts for the origin of human PDZ-RGS3." Kehrl J.H., Srikumar D., Harrison K., Wilson G.L., Shi C.S. Genomics 79:860-868(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 6), NUCLEOTIDE SEQUENCE [MRNA] OF 105-1198 (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 5). Tissue: Amygdala and Testis. |
| [4] | "Human PDZ-RGS3." Chatterjee T.K., Fisher R.A. Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 4). |
| [5] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Puhl H.L. III, Ikeda S.R., Aronstam R.S. Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [6] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Brain. |
| [9] | "RGS3 inhibits G protein-mediated signaling via translocation to the membrane and binding to Galpha11." Dulin N.O., Sorokin A., Reed E., Elliott S., Kehrl J.H., Dunn M.J. Mol. Cell. Biol. 19:714-723(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH GNA11 AND GNA13, SUBCELLULAR LOCATION. |
| [10] | "Regulator of G protein signaling RGS3T is localized to the nucleus and induces apoptosis." Dulin N.O., Pratt P., Tiruppathi C., Niu J., Voyno-Yasenetskaya T., Dunn M.J. J. Biol. Chem. 275:21317-21323(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [11] | "Regulator of G-protein signaling 3 (RGS3) inhibits G-beta1/gamma2-induced inositol phosphate production, mitogen-activated protein kinase activation, and Akt activation." Shi C.-S., Lee S.B., Sinnarajah S., Dessauer C.W., Rhee S.G., Kehrl J.H. J. Biol. Chem. 276:24293-24300(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH HETERODIMERIC GNB1-GNG2, SUBCELLULAR LOCATION. |
| [12] | "Identification and Herc5-mediated ISGylation of novel target proteins." Takeuchi T., Inoue S., Yokosawa H. Biochem. Biophys. Res. Commun. 348:473-477(2006) [PubMed] [Europe PMC] [Abstract] Cited for: ISGYLATION. |
| [13] | "Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line." Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S. Electrophoresis 28:2027-2034(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Prostate cancer. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U27655 mRNA. Translation: AAC50394.1. AF490839 mRNA. Translation: AAM33254.1. Different initiation. AF490840 mRNA. Translation: AAM33255.1. AK074977 mRNA. Translation: BAC11328.1. AK128127 mRNA. Translation: BAC87285.1. AK289666 mRNA. Translation: BAF82355.1. AF493927 mRNA. Translation: AAM12641.1. AF493941 mRNA. Translation: AAM12655.1. AY585192 mRNA. Translation: AAT79495.1. AF463495 Genomic DNA. Translation: AAL68829.1. AL162727 Genomic DNA. Translation: CAC78977.1. AL162727, AL359455 Genomic DNA. Translation: CAH70841.1. AL162727, AL137066, AL359455 Genomic DNA. Translation: CAH70843.1. AL137066, AL162727, AL359455 Genomic DNA. Translation: CAH70102.1. AL137066, AL359455 Genomic DNA. Translation: CAH70103.1. AL359455, AL137066 Genomic DNA. Translation: CAH73880.1. AL359455, AL162727 Genomic DNA. Translation: CAH73877.1. AL359455, AL137066, AL162727 Genomic DNA. Translation: CAH73879.1. CH471090 Genomic DNA. Translation: EAW87391.1. CH471090 Genomic DNA. Translation: EAW87393.1. BC042555 mRNA. Translation: AAH42555.1. | ||||||||||||||||||||||||
| IPI | IPI00181533. IPI00328216. IPI00385923. IPI00418780. IPI00473078. IPI00604741. | ||||||||||||||||||||||||
| PIR | S78089. | ||||||||||||||||||||||||
| RefSeq | NP_001263189.1. NM_001276260.1. NP_060260.3. NM_017790.4. NP_066929.1. NM_021106.3. NP_570613.2. NM_130795.3. NP_652759.3. NM_144488.5. | ||||||||||||||||||||||||
| UniGene | Hs.494875. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P49796. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | P49796. 13 interactions. | ||||||||||||||||||||||||
| MINT | MINT-136831. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P49796. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 67477383. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | P49796. | ||||||||||||||||||||||||
| PRIDE | P49796. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000317613; ENSP00000312844; ENSG00000138835. ENST00000343817; ENSP00000340284; ENSG00000138835. ENST00000350696; ENSP00000259406; ENSG00000138835. ENST00000374134; ENSP00000363249; ENSG00000138835. ENST00000374140; ENSP00000363255; ENSG00000138835. ENST00000462143; ENSP00000420356; ENSG00000138835. | ||||||||||||||||||||||||
| GeneID | 5998. | ||||||||||||||||||||||||
| KEGG | hsa:5998. | ||||||||||||||||||||||||
| UCSC | uc004bhq.3. human. uc004bhr.3. human. uc004bht.3. human. uc004bhv.3. human. uc004bhw.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 5998. | ||||||||||||||||||||||||
| GeneCards | GC09P116207. | ||||||||||||||||||||||||
| HGNC | HGNC:9999. RGS3. | ||||||||||||||||||||||||
| HPA | CAB032507. | ||||||||||||||||||||||||
| MIM | 602189. gene. | ||||||||||||||||||||||||
| neXtProt | NX_P49796. | ||||||||||||||||||||||||
| PharmGKB | PA34374. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG266213. | ||||||||||||||||||||||||
| HOVERGEN | HBG013233. | ||||||||||||||||||||||||
| InParanoid | P49796. | ||||||||||||||||||||||||
| KO | K07524. | ||||||||||||||||||||||||
| OMA | FTGHRKM. | ||||||||||||||||||||||||
| OrthoDB | EOG4GB76T. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Pathway_Interaction_DB | ephrinbrevpathway. Ephrin B reverse signaling. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P49796. | ||||||||||||||||||||||||
| Bgee | P49796. | ||||||||||||||||||||||||
| Genevestigator | P49796. | ||||||||||||||||||||||||
| GermOnline | ENSG00000138835. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 1.10.196.10. 2 hits. 2.30.29.30. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR001478. PDZ. IPR011993. PH_like_dom. IPR000342. Regulat_G_prot_signal. IPR024066. Regulat_G_prot_signal_dom1. IPR016137. Regulat_G_prot_signal_superfam. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00168. C2. 1 hit. PF00595. PDZ. 1 hit. PF00615. RGS. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR01301. RGSPROTEIN. | ||||||||||||||||||||||||
| SMART | SM00239. C2. 1 hit. SM00228. PDZ. 1 hit. SM00315. RGS. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF50156. PDZ. 1 hit. SSF48097. Regulat_G_prot_signal_superfam. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50004. C2. 1 hit. PS50106. PDZ. 1 hit. PS50132. RGS. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | RGS3. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | P49796. | ||||||||||||||||||||||||
| GenomeRNAi | 5998. | ||||||||||||||||||||||||
| NextBio | 23375. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | RGS3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P49796 Secondary accession number(s): A6NHA0 Q8WXA0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
