Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P49796

- RGS3_HUMAN

UniProt

P49796 - RGS3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Regulator of G-protein signaling 3

Gene

RGS3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.4 Publications

GO - Molecular functioni

  1. GTPase activator activity Source: RefGenome

GO - Biological processi

  1. inactivation of MAPK activity Source: ProtInc
  2. positive regulation of GTPase activity Source: GOC
  3. regulation of G-protein coupled receptor protein signaling pathway Source: ProtInc
  4. termination of G-protein coupled receptor signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Signal transduction inhibitor

Names & Taxonomyi

Protein namesi
Recommended name:
Regulator of G-protein signaling 3
Short name:
RGP3
Short name:
RGS3
Gene namesi
Name:RGS3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:9999. RGS3.

Subcellular locationi

Cytoplasm. Nucleus. Cell membrane Curated; Peripheral membrane protein Curated
Note: Long isoforms are cytoplasmic and associated with the plasma membrane. Short isoforms are nuclear.

GO - Cellular componenti

  1. cytoplasm Source: RefGenome
  2. cytosol Source: ProtInc
  3. nucleus Source: UniProtKB-KW
  4. plasma membrane Source: RefGenome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34374.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11981198Regulator of G-protein signaling 3PRO_0000204182Add
BLAST

Post-translational modificationi

Phosphorylated by cyclic GMP-dependent protein kinase.By similarity
ISGylated.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP49796.
PaxDbiP49796.
PRIDEiP49796.

PTM databases

PhosphoSiteiP49796.

Expressioni

Gene expression databases

BgeeiP49796.
ExpressionAtlasiP49796. baseline and differential.
GenevestigatoriP49796.

Organism-specific databases

HPAiCAB032507.

Interactioni

Subunit structurei

Binds EFNB1 and EFNB2 By similarity. Binds the GNB1-GNG2 heterodimer.By similarity

Protein-protein interaction databases

BioGridi111930. 16 interactions.
IntActiP49796. 16 interactions.
MINTiMINT-136831.

Structurei

Secondary structure

1
1198
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi140 – 16122Combined sources
Beta strandi166 – 1683Combined sources
Beta strandi172 – 1809Combined sources
Beta strandi200 – 2089Combined sources
Helixi211 – 2133Combined sources
Beta strandi216 – 2249Combined sources
Helixi229 – 2313Combined sources
Beta strandi233 – 2419Combined sources
Helixi242 – 2454Combined sources
Beta strandi252 – 2576Combined sources
Helixi263 – 2653Combined sources
Beta strandi300 – 3034Combined sources
Beta strandi310 – 3145Combined sources
Beta strandi316 – 3183Combined sources
Beta strandi320 – 3245Combined sources
Helixi329 – 3335Combined sources
Beta strandi340 – 3445Combined sources
Helixi354 – 3629Combined sources
Beta strandi365 – 37410Combined sources
Helixi1066 – 10705Combined sources
Helixi1074 – 10785Combined sources
Helixi1081 – 109313Combined sources
Helixi1097 – 110913Combined sources
Helixi1115 – 112915Combined sources
Helixi1142 – 11509Combined sources
Turni1157 – 11604Combined sources
Helixi1161 – 117313Combined sources
Helixi1175 – 11817Combined sources
Helixi1183 – 11864Combined sources
Turni1187 – 11893Combined sources

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2F5YX-ray2.39A/B300-384[»]
2OJ4X-ray2.30A1064-1190[»]
3FBKX-ray2.00A/B134-276[»]
ProteinModelPortaliP49796.
SMRiP49796. Positions 136-275, 299-376, 1064-1190.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP49796.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini137 – 239103C2PROSITE-ProRule annotationAdd
BLAST
Domaini299 – 37678PDZPROSITE-ProRule annotationAdd
BLAST
Domaini1073 – 1198126RGSPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi705 – 819115Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 RGS domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG266213.
GeneTreeiENSGT00760000118903.
HOVERGENiHBG013233.
InParanoidiP49796.
KOiK07524.
OMAiQEPRGPC.
OrthoDBiEOG7VHSZ5.
PhylomeDBiP49796.
TreeFamiTF351952.

Family and domain databases

Gene3Di1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
IPR001478. PDZ.
IPR011993. PH_like_dom.
IPR024066. Regulat_G_prot_signal_dom1.
IPR016137. Regulat_G_prot_signal_superfam.
IPR000342. RGS_dom.
[Graphical view]
PfamiPF00168. C2. 1 hit.
PF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSiPR01301. RGSPROTEIN.
SMARTiSM00239. C2. 1 hit.
SM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF48097. SSF48097. 1 hit.
SSF49562. SSF49562. 1 hit.
SSF50156. SSF50156. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform 3 (identifier: P49796-3) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVIPALWEV EMGRSQGQEI ETILANRSHS DSTPLPNFLS GSHRPECCTC
60 70 80 90 100
RLLTASGAQD SLPFGRRLYS GPWRSCEEVC HVSVLSVLST SCGLSLSLPI
110 120 130 140 150
FPGWMEWLSP DIALPRRDEW TQTSPARKRI THAKVQGAGQ LRLSIDAQDR
160 170 180 190 200
VLLLHIIEGK GLISKQPGTC DPYVKISLIP EDSRLRHQKT QTVPDCRDPA
210 220 230 240 250
FHEHFFFPVQ EEDDQKRLLV TVWNRASQSR QSGLIGCMSF GVKSLLTPDK
260 270 280 290 300
EISGWYYLLG EHLGRTKHLK VARRRLRPLR DPLLRMPGGG DTENGKKLKI
310 320 330 340 350
TIPRGKDGFG FTICCDSPVR VQAVDSGGPA ERAGLQQLDT VLQLNERPVE
360 370 380 390 400
HWKCVELAHE IRSCPSEIIL LVWRMVPQVK PGPDGGVLRR ASCKSTHDLQ
410 420 430 440 450
SPPNKREKNC THGVQARPEQ RHSCHLVCDS SDGLLLGGWE RYTEVAKRGG
460 470 480 490 500
QHTLPALSRA TAPTDPNYII LAPLNPGSQL LRPVYQEDTI PEESGSPSKG
510 520 530 540 550
KSYTGLGKKS RLMKTVQTMK GHGNYQNCPV VRPHATHSSY GTYVTLAPKV
560 570 580 590 600
LVFPVFVQPL DLCNPARTLL LSEELLLYEG RNKAAEVTLF AYSDLLLFTK
610 620 630 640 650
EDEPGRCDVL RNPLYLQSVK LQEGSSEDLK FCVLYLAEKA ECLFTLEAHS
660 670 680 690 700
QEQKKRVCWC LSENIAKQQQ LAASPPDSKM FETEADEKRE MALEEGKGPG
710 720 730 740 750
AEDSPPSKEP SPGQELPPGQ DLPPNKDSPS GQEPAPSQEP LSSKDSATSE
760 770 780 790 800
GSPPGPDAPP SKDVPPCQEP PPAQDLSPCQ DLPAGQEPLP HQDPLLTKDL
810 820 830 840 850
PAIQESPTRD LPPCQDLPPS QVSLPAKALT EDTMSSGDLL AATGDPPAAP
860 870 880 890 900
RPAFVIPEVR LDSTYSQKAG AEQGCSGDEE DAEEAEEVEE GEEGEEDEDE
910 920 930 940 950
DTSDDNYGER SEAKRSSMIE TGQGAEGGLS LRVQNSLRRR THSEGSLLQE
960 970 980 990 1000
PRGPCFASDT TLHCSDGEGA ASTWGMPSPS TLKKELGRNG GSMHHLSLFF
1010 1020 1030 1040 1050
TGHRKMSGAD TVGDDDEASR KRKSKNLAKD MKNKLGIFRR RNESPGAPPA
1060 1070 1080 1090 1100
GKADKMMKSF KPTSEEALKW GESLEKLLVH KYGLAVFQAF LRTEFSEENL
1110 1120 1130 1140 1150
EFWLACEDFK KVKSQSKMAS KAKKIFAEYI AIQACKEVNL DSYTREHTKD
1160 1170 1180 1190
NLQSVTRGCF DLAQKRIFGL MEKDSYPRFL RSDLYLDLIN QKKMSPPL
Length:1,198
Mass (Da):132,336
Last modified:June 7, 2005 - v2
Checksum:iE615DA49022EFFE4
GO
Isoform 1 (identifier: P49796-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-679: Missing.

Show »
Length:519
Mass (Da):56,602
Checksum:iF1CFE3F27D4673A0
GO
Isoform 2 (identifier: P49796-2) [UniParc]FASTAAdd to Basket

Also known as: RGS3T

The sequence of this isoform differs from the canonical sequence as follows:
     1-992: Missing.

Note: Nuclear.

Show »
Length:206
Mass (Da):23,725
Checksum:iE24047B4952692D4
GO
Isoform 4 (identifier: P49796-4) [UniParc]FASTAAdd to Basket

Also known as: 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-281: Missing.
     282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ

Show »
Length:917
Mass (Da):100,948
Checksum:i17D77BE23D0A1C52
GO
Isoform 5 (identifier: P49796-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-112: Missing.
     113-138: ALPRRDEWTQTSPARKRITHAKVQGA → MERSLHRVSLGSRRAHPDLSFYLTTF
     680-714: MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQ → KLHPFGSLQQEMGPVNSTNATQDRSFTSPGQTLIG
     715-1198: Missing.

Show »
Length:602
Mass (Da):67,282
Checksum:i1976A77C3FC3933F
GO
Isoform 6 (identifier: P49796-6) [UniParc]FASTAAdd to Basket

Also known as: C2PA-RGS3

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.

Show »
Length:1,094
Mass (Da):121,008
Checksum:i9465608DAA6F95B6
GO
Isoform 7 (identifier: P49796-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE

Note: No experimental confirmation available.

Show »
Length:311
Mass (Da):35,108
Checksum:i6886A35CF3ADF13E
GO
Isoform 8 (identifier: P49796-8) [UniParc]FASTAAdd to Basket

Also known as: RGS3S

The sequence of this isoform differs from the canonical sequence as follows:
     1-1027: MPVIPALWEV...ASRKRKSKNL → MVTRRPVTNS...NLQRRHTMKE
     1198-1198: L → LDYKDDDDK

Show »
Length:319
Mass (Da):36,103
Checksum:iB667E606719743CF
GO
Isoform 9 (identifier: P49796-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-281: Missing.
     282-299: PLLRMPGGGDTENGKKLK → MNRFNGLCKVCSERRYRQ
     679-1004: Missing.

Note: No experimental confirmation available.

Show »
Length:591
Mass (Da):66,478
Checksum:i379E2AA9DB27D837
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti170 – 1701C → W in AAM33254. (PubMed:12036301)Curated
Sequence conflicti206 – 2061F → S in BAC11328. (PubMed:14702039)Curated
Sequence conflicti266 – 2661T → A in AAM33254. (PubMed:12036301)Curated
Sequence conflicti462 – 4621A → V in AAL68829. 1 PublicationCurated
Sequence conflicti585 – 5851A → V in AAM33255. (PubMed:12036301)Curated
Sequence conflicti632 – 6321C → R in BAC11328. (PubMed:14702039)Curated
Sequence conflicti705 – 7051Missing in AAM33254. (PubMed:12036301)Curated
Sequence conflicti725 – 7251N → S in AAH42555. (PubMed:15489334)Curated
Sequence conflicti873 – 8731Q → H in AAM33254. (PubMed:12036301)Curated
Sequence conflicti883 – 8842EE → KQ in AAM33254. (PubMed:12036301)Curated
Sequence conflicti984 – 9841K → R in AAM12641. 1 PublicationCurated
Sequence conflicti1127 – 11271A → V in AAM33253. (PubMed:12036301)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti129 – 1291R → K.
Corresponds to variant rs16933949 [ dbSNP | Ensembl ].
VAR_051794
Natural varianti809 – 8091R → Q.
Corresponds to variant rs41305473 [ dbSNP | Ensembl ].
VAR_061769

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 10271027MPVIP…KSKNL → MVTRRPVTNSWDWLPAGAAP EAVPCRHMPLSRLPLRVGQK EFFFPLPLLVPPISWLLLSE SQPRLVPGSPVIRPGFQRAC VAAACTVAARCPGRGVGDRS QSGASYRPICGPKVGGPTEM LRGMYLTRNGNLQRRHTMKE in isoform 7 and isoform 8. 1 PublicationVSP_047029Add
BLAST
Alternative sequencei1 – 992992Missing in isoform 2. 1 PublicationVSP_005662Add
BLAST
Alternative sequencei1 – 679679Missing in isoform 1. 4 PublicationsVSP_013958Add
BLAST
Alternative sequencei1 – 281281Missing in isoform 4 and isoform 9. 5 PublicationsVSP_013959Add
BLAST
Alternative sequencei1 – 112112Missing in isoform 5. 1 PublicationVSP_013961Add
BLAST
Alternative sequencei1 – 104104Missing in isoform 6. 1 PublicationVSP_013960Add
BLAST
Alternative sequencei113 – 13826ALPRR…KVQGA → MERSLHRVSLGSRRAHPDLS FYLTTF in isoform 5. 1 PublicationVSP_013962Add
BLAST
Alternative sequencei282 – 29918PLLRM…GKKLK → MNRFNGLCKVCSERRYRQ in isoform 4 and isoform 9. 5 PublicationsVSP_013963Add
BLAST
Alternative sequencei679 – 1004326Missing in isoform 9. 1 PublicationVSP_054690Add
BLAST
Alternative sequencei680 – 71435MFETE…PSPGQ → KLHPFGSLQQEMGPVNSTNA TQDRSFTSPGQTLIG in isoform 5. 1 PublicationVSP_013964Add
BLAST
Alternative sequencei715 – 1198484Missing in isoform 5. 1 PublicationVSP_013965Add
BLAST
Alternative sequencei1198 – 11981L → LDYKDDDDK in isoform 8. 1 PublicationVSP_053533

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U27655 mRNA. Translation: AAC50394.1.
AF490838 mRNA. Translation: AAM33253.1.
AF490839 mRNA. Translation: AAM33254.1.
AF490840 mRNA. Translation: AAM33255.1.
AK074977 mRNA. Translation: BAC11328.1.
AK096840 mRNA. Translation: BAG53374.1.
AK128127 mRNA. Translation: BAC87285.1.
AK289666 mRNA. Translation: BAF82355.1.
AF493927 mRNA. Translation: AAM12641.1.
AF493941 mRNA. Translation: AAM12655.1.
AY585192 mRNA. Translation: AAT79495.1.
AF463495 Genomic DNA. Translation: AAL68829.1.
AL162727 Genomic DNA. Translation: CAC78977.1.
AL162727, AL359455 Genomic DNA. Translation: CAH70841.1.
AL162727, AL137066, AL359455 Genomic DNA. Translation: CAH70843.1.
AL137066, AL162727, AL359455 Genomic DNA. Translation: CAH70102.1.
AL137066, AL359455 Genomic DNA. Translation: CAH70103.1.
AL359455, AL137066 Genomic DNA. Translation: CAH73880.1.
AL359455, AL162727 Genomic DNA. Translation: CAH73877.1.
AL359455, AL137066, AL162727 Genomic DNA. Translation: CAH73879.1.
CH471090 Genomic DNA. Translation: EAW87388.1.
CH471090 Genomic DNA. Translation: EAW87391.1.
CH471090 Genomic DNA. Translation: EAW87393.1.
BC019039 mRNA. Translation: AAH19039.3.
BC042555 mRNA. Translation: AAH42555.1.
CCDSiCCDS35113.1. [P49796-5]
CCDS35114.1. [P49796-7]
CCDS43869.1. [P49796-3]
CCDS65111.1. [P49796-9]
CCDS6797.1. [P49796-4]
CCDS6798.1. [P49796-1]
PIRiS78089.
RefSeqiNP_001263189.1. NM_001276260.1. [P49796-1]
NP_001263190.1. NM_001276261.1. [P49796-9]
NP_001263191.1. NM_001276262.1.
NP_001269851.1. NM_001282922.1. [P49796-1]
NP_001269852.1. NM_001282923.1.
NP_060260.3. NM_017790.4. [P49796-5]
NP_570613.2. NM_130795.3. [P49796-4]
NP_602299.1. NM_134427.2.
NP_652759.3. NM_144488.5. [P49796-3]
NP_652760.2. NM_144489.3. [P49796-7]
XP_006717282.1. XM_006717219.1. [P49796-6]
XP_006717289.1. XM_006717226.1. [P49796-1]
XP_006717290.1. XM_006717227.1. [P49796-1]
XP_006717291.1. XM_006717228.1. [P49796-1]
XP_006717292.1. XM_006717229.1. [P49796-1]
XP_006717293.1. XM_006717230.1. [P49796-1]
UniGeneiHs.494875.

Genome annotation databases

EnsembliENST00000317613; ENSP00000312844; ENSG00000138835. [P49796-5]
ENST00000343817; ENSP00000340284; ENSG00000138835. [P49796-4]
ENST00000350696; ENSP00000259406; ENSG00000138835. [P49796-3]
ENST00000374134; ENSP00000363249; ENSG00000138835. [P49796-1]
ENST00000374140; ENSP00000363255; ENSG00000138835. [P49796-3]
ENST00000394646; ENSP00000378141; ENSG00000138835. [P49796-9]
ENST00000462143; ENSP00000420356; ENSG00000138835. [P49796-1]
ENST00000462403; ENSP00000436168; ENSG00000138835. [P49796-7]
ENST00000613049; ENSP00000482612; ENSG00000138835. [P49796-7]
GeneIDi5998.
KEGGihsa:5998.
UCSCiuc004bhq.4. human. [P49796-3]
uc004bhr.4. human. [P49796-5]
uc004bht.4. human. [P49796-4]
uc004bhv.4. human. [P49796-1]
uc004bia.4. human.
uc010muy.4. human.

Polymorphism databases

DMDMi67477383.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U27655 mRNA. Translation: AAC50394.1 .
AF490838 mRNA. Translation: AAM33253.1 .
AF490839 mRNA. Translation: AAM33254.1 .
AF490840 mRNA. Translation: AAM33255.1 .
AK074977 mRNA. Translation: BAC11328.1 .
AK096840 mRNA. Translation: BAG53374.1 .
AK128127 mRNA. Translation: BAC87285.1 .
AK289666 mRNA. Translation: BAF82355.1 .
AF493927 mRNA. Translation: AAM12641.1 .
AF493941 mRNA. Translation: AAM12655.1 .
AY585192 mRNA. Translation: AAT79495.1 .
AF463495 Genomic DNA. Translation: AAL68829.1 .
AL162727 Genomic DNA. Translation: CAC78977.1 .
AL162727 , AL359455 Genomic DNA. Translation: CAH70841.1 .
AL162727 , AL137066 , AL359455 Genomic DNA. Translation: CAH70843.1 .
AL137066 , AL162727 , AL359455 Genomic DNA. Translation: CAH70102.1 .
AL137066 , AL359455 Genomic DNA. Translation: CAH70103.1 .
AL359455 , AL137066 Genomic DNA. Translation: CAH73880.1 .
AL359455 , AL162727 Genomic DNA. Translation: CAH73877.1 .
AL359455 , AL137066 , AL162727 Genomic DNA. Translation: CAH73879.1 .
CH471090 Genomic DNA. Translation: EAW87388.1 .
CH471090 Genomic DNA. Translation: EAW87391.1 .
CH471090 Genomic DNA. Translation: EAW87393.1 .
BC019039 mRNA. Translation: AAH19039.3 .
BC042555 mRNA. Translation: AAH42555.1 .
CCDSi CCDS35113.1. [P49796-5 ]
CCDS35114.1. [P49796-7 ]
CCDS43869.1. [P49796-3 ]
CCDS65111.1. [P49796-9 ]
CCDS6797.1. [P49796-4 ]
CCDS6798.1. [P49796-1 ]
PIRi S78089.
RefSeqi NP_001263189.1. NM_001276260.1. [P49796-1 ]
NP_001263190.1. NM_001276261.1. [P49796-9 ]
NP_001263191.1. NM_001276262.1.
NP_001269851.1. NM_001282922.1. [P49796-1 ]
NP_001269852.1. NM_001282923.1.
NP_060260.3. NM_017790.4. [P49796-5 ]
NP_570613.2. NM_130795.3. [P49796-4 ]
NP_602299.1. NM_134427.2.
NP_652759.3. NM_144488.5. [P49796-3 ]
NP_652760.2. NM_144489.3. [P49796-7 ]
XP_006717282.1. XM_006717219.1. [P49796-6 ]
XP_006717289.1. XM_006717226.1. [P49796-1 ]
XP_006717290.1. XM_006717227.1. [P49796-1 ]
XP_006717291.1. XM_006717228.1. [P49796-1 ]
XP_006717292.1. XM_006717229.1. [P49796-1 ]
XP_006717293.1. XM_006717230.1. [P49796-1 ]
UniGenei Hs.494875.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2F5Y X-ray 2.39 A/B 300-384 [» ]
2OJ4 X-ray 2.30 A 1064-1190 [» ]
3FBK X-ray 2.00 A/B 134-276 [» ]
ProteinModelPortali P49796.
SMRi P49796. Positions 136-275, 299-376, 1064-1190.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111930. 16 interactions.
IntActi P49796. 16 interactions.
MINTi MINT-136831.

PTM databases

PhosphoSitei P49796.

Polymorphism databases

DMDMi 67477383.

Proteomic databases

MaxQBi P49796.
PaxDbi P49796.
PRIDEi P49796.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000317613 ; ENSP00000312844 ; ENSG00000138835 . [P49796-5 ]
ENST00000343817 ; ENSP00000340284 ; ENSG00000138835 . [P49796-4 ]
ENST00000350696 ; ENSP00000259406 ; ENSG00000138835 . [P49796-3 ]
ENST00000374134 ; ENSP00000363249 ; ENSG00000138835 . [P49796-1 ]
ENST00000374140 ; ENSP00000363255 ; ENSG00000138835 . [P49796-3 ]
ENST00000394646 ; ENSP00000378141 ; ENSG00000138835 . [P49796-9 ]
ENST00000462143 ; ENSP00000420356 ; ENSG00000138835 . [P49796-1 ]
ENST00000462403 ; ENSP00000436168 ; ENSG00000138835 . [P49796-7 ]
ENST00000613049 ; ENSP00000482612 ; ENSG00000138835 . [P49796-7 ]
GeneIDi 5998.
KEGGi hsa:5998.
UCSCi uc004bhq.4. human. [P49796-3 ]
uc004bhr.4. human. [P49796-5 ]
uc004bht.4. human. [P49796-4 ]
uc004bhv.4. human. [P49796-1 ]
uc004bia.4. human.
uc010muy.4. human.

Organism-specific databases

CTDi 5998.
GeneCardsi GC09P116207.
HGNCi HGNC:9999. RGS3.
HPAi CAB032507.
MIMi 602189. gene.
neXtProti NX_P49796.
PharmGKBi PA34374.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG266213.
GeneTreei ENSGT00760000118903.
HOVERGENi HBG013233.
InParanoidi P49796.
KOi K07524.
OMAi QEPRGPC.
OrthoDBi EOG7VHSZ5.
PhylomeDBi P49796.
TreeFami TF351952.

Miscellaneous databases

ChiTaRSi RGS3. human.
EvolutionaryTracei P49796.
GeneWikii RGS3.
GenomeRNAii 5998.
NextBioi 23375.
PROi P49796.
SOURCEi Search...

Gene expression databases

Bgeei P49796.
ExpressionAtlasi P49796. baseline and differential.
Genevestigatori P49796.

Family and domain databases

Gene3Di 1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
2.60.40.150. 1 hit.
InterProi IPR000008. C2_dom.
IPR001478. PDZ.
IPR011993. PH_like_dom.
IPR024066. Regulat_G_prot_signal_dom1.
IPR016137. Regulat_G_prot_signal_superfam.
IPR000342. RGS_dom.
[Graphical view ]
Pfami PF00168. C2. 1 hit.
PF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view ]
PRINTSi PR01301. RGSPROTEIN.
SMARTi SM00239. C2. 1 hit.
SM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view ]
SUPFAMi SSF48097. SSF48097. 1 hit.
SSF49562. SSF49562. 1 hit.
SSF50156. SSF50156. 1 hit.
PROSITEi PS50004. C2. 1 hit.
PS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Inhibition of G-protein-mediated MAP kinase activation by a new mammalian gene family."
    Druey K.M., Blumer K.J., Kang V.H., Kehrl J.H.
    Nature 379:742-746(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
  2. "Additional 5' exons in the RGS3 locus generate multiple mRNA transcripts, one of which accounts for the origin of human PDZ-RGS3."
    Kehrl J.H., Srikumar D., Harrison K., Wilson G.L., Shi C.S.
    Genomics 79:860-868(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4; 6 AND 8), NUCLEOTIDE SEQUENCE [MRNA] OF 105-1198 (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 5 AND 9).
    Tissue: Amygdala and Testis.
  4. "Human PDZ-RGS3."
    Chatterjee T.K., Fisher R.A.
    Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 4).
  5. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
    Puhl H.L. III, Ikeda S.R., Aronstam R.S.
    Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  6. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    Tissue: Brain and Kidney.
  9. "RGS3 inhibits G protein-mediated signaling via translocation to the membrane and binding to Galpha11."
    Dulin N.O., Sorokin A., Reed E., Elliott S., Kehrl J.H., Dunn M.J.
    Mol. Cell. Biol. 19:714-723(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH GNA11 AND GNA13, SUBCELLULAR LOCATION.
  10. "Regulator of G protein signaling RGS3T is localized to the nucleus and induces apoptosis."
    Dulin N.O., Pratt P., Tiruppathi C., Niu J., Voyno-Yasenetskaya T., Dunn M.J.
    J. Biol. Chem. 275:21317-21323(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  11. "Regulator of G-protein signaling 3 (RGS3) inhibits G-beta1/gamma2-induced inositol phosphate production, mitogen-activated protein kinase activation, and Akt activation."
    Shi C.-S., Lee S.B., Sinnarajah S., Dessauer C.W., Rhee S.G., Kehrl J.H.
    J. Biol. Chem. 276:24293-24300(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH HETERODIMERIC GNB1-GNG2, SUBCELLULAR LOCATION.
  12. "Identification and Herc5-mediated ISGylation of novel target proteins."
    Takeuchi T., Inoue S., Yokosawa H.
    Biochem. Biophys. Res. Commun. 348:473-477(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: ISGYLATION.
  13. "Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line."
    Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S.
    Electrophoresis 28:2027-2034(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Prostate cancer.

Entry informationi

Entry nameiRGS3_HUMAN
AccessioniPrimary (citable) accession number: P49796
Secondary accession number(s): A6NHA0
, A8K0V1, B3KUB2, Q5VXB8, Q5VXC1, Q5VZ05, Q5VZ06, Q6ZRM5, Q8IUQ1, Q8NC47, Q8NFN4, Q8NFN5, Q8NFN6, Q8TD59, Q8TD68, Q8WV02, Q8WXA0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: June 7, 2005
Last modified: October 29, 2014
This is version 155 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3