P49759 (CLK1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 130.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dual specificity protein kinase CLK1 EC=2.7.12.1 Alternative name(s): CDC-like kinase 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 484 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. Phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex and may be a constituent of a network of regulatory mechanisms that enable SR proteins to control RNA splicing. Phosphorylates: SRSF1, SRSF3 and PTPN1. Regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells and adenovirus E1A pre-mRNA. Ref.7 Ref.13 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme regulation | Regulates splicing of its own pre-mRNA according to its kinase activity; increased expression of the catalytically active form influences splicing to generate the catalytically inactive splicing variant lacking the kinase domain. Leucettine L41 inhibits its kinase activity and affects the regulation of alternative splicing mediated by phosphorylation of SR proteins By similarity. |
| Subunit structure | Interacts with PPIG and UBL5. Ref.8 |
| Subcellular location | |
| Tissue specificity | Endothelial cells. Ref.13 |
| Post-translational modification | Autophosphorylates on all three types of residues By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. Lammer subfamily. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P49759-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P49759-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 131-136: KSHRRK → MKLLIL 137-484: Missing. | ||||||
| Note: Lacks the kinase domain. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: P49759-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAAGRRPASALWPERRGSPLRGDLLGFQNVREPSSCGETLSGM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 484 | 484 | Dual specificity protein kinase CLK1 | PRO_0000085866 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 161 – 477 | 317 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 167 – 175 | 9 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 288 | 1 | Proton acceptor By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 191 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 61 | 1 | Phosphoserine Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 138 | 1 | Phosphothreonine Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 140 | 1 | Phosphoserine Ref.10 Ref.11 Ref.12 Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MAAGRRPASALWPERRGSPL RGDLLGFQNVREPSSCGETL SGM in isoform 3. | VSP_043578 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 131 – 136 | 6 | KSHRRK → MKLLIL in isoform 2. | VSP_004852 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 137 – 484 | 348 | Missing in isoform 2. | VSP_004853 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 61 | 1 | S → F. Ref.15 Corresponds to variant rs55989135 [ dbSNP | Ensembl ]. | VAR_040409 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 99 | 1 | N → D. Corresponds to variant rs6735666 [ dbSNP | Ensembl ]. | VAR_046551 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 118 | 1 | R → G. Ref.15 Corresponds to variant rs56135616 [ dbSNP | Ensembl ]. | VAR_040410 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 307 | 1 | P → S. Ref.15 Corresponds to variant rs35412475 [ dbSNP | Ensembl ]. | VAR_040411 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 440 | 1 | M → T. Ref.15 Corresponds to variant rs35393352 [ dbSNP | Ensembl ]. | VAR_040412 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 459 | 1 | E → G. Corresponds to variant rs12709 [ dbSNP | Ensembl ]. | VAR_051620 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 432 | 1 | R → A in AAA61480. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 148 – 150 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 158 – 160 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 161 – 170 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 173 – 180 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 181 – 185 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 187 – 193 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 197 – 216 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 227 – 233 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 236 – 242 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 248 – 254 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 255 – 257 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 262 – 281 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 291 – 293 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 294 – 297 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 301 – 305 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 312 – 317 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 321 – 323 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 343 – 345 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 348 – 351 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 359 – 374 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 384 – 395 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 400 – 405 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 409 – 411 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 424 – 432 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 436 – 439 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 445 – 457 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 462 – 464 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 468 – 471 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 475 – 481 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of a novel human cdc2/CDC28-like protein kinase." Johnson K.W., Smith K.A. J. Biol. Chem. 266:3402-3407(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Characterization by cDNA cloning of two new human protein kinases. Evidence by sequence comparison of a new family of mammalian protein kinases." Hanes J.J., der Kammer H., Klaudiny J.J., Scheit K.H. J. Mol. Biol. 244:665-672(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Amygdala. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Blood and Bone. |
| [7] | "The CLK family kinases, CLK1 and CLK2, phosphorylate and activate the tyrosine phosphatase, PTP-1B." Moeslein F.M., Myers M.P., Landreth G.E. J. Biol. Chem. 274:26697-26704(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "Beacon interacts with cdc2/cdc28-like kinases." Kantham L., Kerr-Bayles L., Godde N., Quick M., Webb R., Sunderland T., Bond J., Walder K., Augert G., Collier G. Biochem. Biophys. Res. Commun. 304:125-129(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH UBL5. |
| [9] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [10] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-61 AND SER-140, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-138 AND SER-140, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells." Eisenreich A., Bogdanov V.Y., Zakrzewicz A., Pries A., Antoniak S., Poller W., Schultheiss H.P., Rauch U. Circ. Res. 104:589-599(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| [14] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140, MASS SPECTROMETRY. |
| [15] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] PHE-61; GLY-118; SER-307 AND THR-440. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L29219 mRNA. Translation: AAA61480.1. L29222 mRNA. Translation: AAB59459.1. AK289365 mRNA. Translation: BAF82054.1. AK294295 mRNA. Translation: BAG57578.1. AC005037 Genomic DNA. Translation: AAY14722.1. CH471063 Genomic DNA. Translation: EAW70217.1. BC028149 mRNA. Translation: AAH28149.1. BC031549 mRNA. Translation: AAH31549.1. | ||||||||||||||||||
| IPI | IPI00028061. IPI00915761. IPI00966856. | ||||||||||||||||||
| PIR | S53641. | ||||||||||||||||||
| RefSeq | NP_001155879.1. NM_001162407.1. NP_004062.2. NM_004071.3. | ||||||||||||||||||
| UniGene | Hs.433732. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P49759. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | P49759. 5 interactions. | ||||||||||||||||||
| MINT | MINT-1416122. | ||||||||||||||||||
| STRING | 9606.ENSP00000326830. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P49759. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 206729857. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | P49759. | ||||||||||||||||||
| PRIDE | P49759. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 1195. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000321356; ENSP00000326830; ENSG00000013441. ENST00000432425; ENSP00000400487; ENSG00000013441. ENST00000434813; ENSP00000394734; ENSG00000013441. | ||||||||||||||||||
| GeneID | 1195. | ||||||||||||||||||
| KEGG | hsa:1195. | ||||||||||||||||||
| UCSC | uc002uwe.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 1195. | ||||||||||||||||||
| GeneCards | GC02M201717. | ||||||||||||||||||
| HGNC | HGNC:2068. CLK1. | ||||||||||||||||||
| HPA | CAB033141. | ||||||||||||||||||
| MIM | 601951. gene. | ||||||||||||||||||
| neXtProt | NX_P49759. | ||||||||||||||||||
| PharmGKB | PA26594. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG0515. | ||||||||||||||||||
| HOGENOM | HOG000203417. | ||||||||||||||||||
| HOVERGEN | HBG107720. | ||||||||||||||||||
| InParanoid | P49759. | ||||||||||||||||||
| KO | K08823. | ||||||||||||||||||
| OMA | SQDVEHE. | ||||||||||||||||||
| OrthoDB | EOG4XD3R2. | ||||||||||||||||||
| PhylomeDB | P49759. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 2.7.12.1. 2681. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P49759. | ||||||||||||||||||
| Bgee | P49759. | ||||||||||||||||||
| CleanEx | HS_CLK1. | ||||||||||||||||||
| Genevestigator | P49759. | ||||||||||||||||||
| GermOnline | ENSG00000013441. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] | ||||||||||||||||||
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||||||||
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| BindingDB | P49759. | ||||||||||||||||||
| ChEMBL | CHEMBL4224. | ||||||||||||||||||
| ChiTaRS | CLK1. human. | ||||||||||||||||||
| EvolutionaryTrace | P49759. | ||||||||||||||||||
| GenomeRNAi | 1195. | ||||||||||||||||||
| NextBio | 4936. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | CLK1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P49759 Secondary accession number(s): B4DFW7, Q0P694, Q8N5V8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
