P49682 (CXCR3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: C-X-C chemokine receptor type 3 Short name=CXC-R3 Short name=CXCR-3 Alternative name(s): CKR-L2 G protein-coupled receptor 9 Interferon-inducible protein 10 receptor Short name=IP-10 receptor CD_antigen=CD183 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 368 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for CXCL9, CXCL10 and CXCL11 and mediates the proliferation of human mesangial cells (HMC). Ref.2 Ref.8 Isoform 2 is a receptor for CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the growth of human microvascular endothelial cells (HMVEC). May play a role in angiogenesis. Ref.2 Ref.8 |
| Subcellular location | |
| Tissue specificity | Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta. Ref.2 |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
| Sequence caution | The sequence CAB02143.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Traceable author statement. Source: ProtInc cellular component movementTraceable author statement. Source: ProtInc chemotaxisTraceable author statement. Source: ProtInc elevation of cytosolic calcium ion concentrationTraceable author statement. Source: ProtInc |
| Cellular component | cytoplasm Traceable author statement. Source: ProtInc integral to plasma membraneTraceable author statement. Source: ProtInc |
| Molecular function | C-X-C chemokine receptor activity Inferred from electronic annotation. Source: InterPro chemokine bindingInferred from physical interaction. Source: BHF-UCL |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P49682-1) Also known as: CXCR3-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P49682-2) Also known as: CXCR3-B; The sequence of this isoform differs from the canonical sequence as follows: 1-4: MVLE → MELRKYGPGRLAGTVIGGAAQSKSQTKSDSITKEFLPGLYTAPSSPFPPSQ | ||||||
| Isoform 3 (identifier: P49682-3) Also known as: CXCR3-alt; The sequence of this isoform differs from the canonical sequence as follows: 210-368: VGRTALRVLQ...ETSEASYSGL → GSSSGSGCGC...AGIRAPLSPI | ||||||
| Note: Due to exon skipping. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 368 | 368 | C-X-C chemokine receptor type 3 | PRO_0000069346 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 53 | 53 | Extracellular Potential | ||||||||
| Transmembrane | 54 – 80 | 27 | Helical; Name=1; Potential | ||||||||
| Topological domain | 81 – 89 | 9 | Cytoplasmic Potential | ||||||||
| Transmembrane | 90 – 110 | 21 | Helical; Name=2; Potential | ||||||||
| Topological domain | 111 – 125 | 15 | Extracellular Potential | ||||||||
| Transmembrane | 126 – 147 | 22 | Helical; Name=3; Potential | ||||||||
| Topological domain | 148 – 169 | 22 | Cytoplasmic Potential | ||||||||
| Transmembrane | 170 – 189 | 20 | Helical; Name=4; Potential | ||||||||
| Topological domain | 190 – 212 | 23 | Extracellular Potential | ||||||||
| Transmembrane | 213 – 233 | 21 | Helical; Name=5; Potential | ||||||||
| Topological domain | 234 – 255 | 22 | Cytoplasmic Potential | ||||||||
| Transmembrane | 256 – 277 | 22 | Helical; Name=6; Potential | ||||||||
| Topological domain | 278 – 298 | 21 | Extracellular Potential | ||||||||
| Transmembrane | 299 – 321 | 23 | Helical; Name=7; Potential | ||||||||
| Topological domain | 322 – 368 | 47 | Cytoplasmic Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 22 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 32 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 124 ↔ 203 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 4 | 4 | MVLE → MELRKYGPGRLAGTVIGGAA QSKSQTKSDSITKEFLPGLY TAPSSPFPPSQ in isoform 2. | VSP_015684 | |||||||
| Alternative sequence | 210 – 368 | 159 | VGRTA…SYSGL → GSSSGSGCGCCSCAWAAPTR EGSRGSHRLPAGIHPGLRPQ RPPTRACEAGIRAPLSPI in isoform 3. | VSP_015685 | |||||||
| Natural variant | 292 | 1 | R → Q. Ref.7 | VAR_016240 | |||||||
| Natural variant | 363 | 1 | A → T. Ref.7 | VAR_016241 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 75 | 1 | A → R in CAB02143. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Chemokine receptor specific for IP10 and mig: structure, function, and expression in activated T-lymphocytes." Loetscher M., Gerber B., Loetscher P., Jones S.A., Piali L., Clark-Lewis I., Baggiolini M., Moser B. J. Exp. Med. 184:963-969(1996) [PubMed: 9064356] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Blood. |
| [2] | "An alternatively spliced variant of CXCR3 mediates the inhibition of endothelial cell growth induced by IP-10, Mig, and I-TAC, and acts as functional receptor for platelet factor 4." Lasagni L., Francalanci M., Annunziato F., Lazzeri E., Giannini S., Cosmi L., Sagrinati C., Mazzinghi B., Orlando C., Maggi E., Marra F., Romagnani S., Serio M., Romagnani P. J. Exp. Med. 197:1537-1549(2003) [PubMed: 12782716] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY. |
| [3] | Gutierrez J., Varona R., Zaballos A., Lind P., Marquez G. Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [4] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Warren C.N., Aronstam R.S., Sharma S.V. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Leukocyte. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain, Lung and Testis. |
| [6] | "Cloning and chromosomal mapping of three novel genes, GPR9, GPR10, and GPR14, encoding receptors related to interleukin 8, neuropeptide Y, and somatostatin receptors." Marchese A., Heiber M., Nguyen T., Heng H.H.Q., Saldivia V.R., Cheng R., Murphy P.M., Tsui L.-C., Shi X., Gregor P., George S.R., O'Dowd B.F., Docherty J.M. Genomics 29:335-344(1995) [PubMed: 8666380] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 5-368. |
| [7] | "Single nucleotide polymorphisms in the coding regions of human CXC-chemokine receptors CXCR1, CXCR2 and CXCR3." Kato H., Tsuchiya N., Tokunaga K. Genes Immun. 1:330-337(2000) [PubMed: 11196695] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 278-368, VARIANTS GLN-292 AND THR-363. |
| [8] | "Identification and partial characterization of a variant of human CXCR3 generated by posttranscriptional exon skipping." Ehlert J.E., Addison C.A., Burdick M.D., Kunkel S.L., Strieter R.M. J. Immunol. 173:6234-6240(2004) [PubMed: 15528361] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 3), FUNCTION. |
| [9] | "Interferon-inducible T cell alpha chemoattractant (I-TAC): a novel non-ELR CXC chemokine with potent activity on activated T cells through selective high affinity binding to CXCR3." Cole K.E., Strick C.A., Paradis T.J., Ogborne K.T., Loetscher M., Gladue R.P., Lin W., Boyd J.G., Moser B., Wood D.E., Sahagan B.G., Neote K. J. Exp. Med. 187:2009-2021(1998) [PubMed: 9625760] [Abstract] Cited for: LIGAND-BINDING. Tissue: Fetal astrocyte. |
| + | Additional computationally mapped references. |
Web resources
| Atlas of Genetics and Cytogenetics in Oncology and Haematology |
| Wikipedia CXC chemokine receptors entry |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X95876 mRNA. Translation: CAA65126.1. AF469635 mRNA. Translation: AAP55851.1. Z79783 Genomic DNA. Translation: CAB02143.1. Different initiation. AY242128 mRNA. Translation: AAO92295.1. BC034403 mRNA. Translation: AAH34403.1. U32674 Genomic DNA. Translation: AAC50505.1. AB032735 Genomic DNA. Translation: BAA92297.1. AB032736 Genomic DNA. Translation: BAA92298.1. |
| IPI | IPI00027754. IPI00640020. IPI00651732. |
| RefSeq | NP_001136269.1. NM_001142797.1. NP_001495.1. NM_001504.1. |
| UniGene | Hs.198252. |
3D structure databases | |
| ProteinModelPortal | P49682. |
| SMR | P49682. Positions 42-336. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-5891N. |
| STRING | P49682. |
Protein family/group databases | |
| GPCRDB | Search... |
Polymorphism databases | |
| DMDM | 2829400. |
Proteomic databases | |
| PRIDE | P49682. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000373693; ENSP00000362797; ENSG00000186810. |
| GeneID | 2833. |
| KEGG | hsa:2833. |
| UCSC | uc004eaf.1. human. |
Organism-specific databases | |
| CTD | 2833. |
| GeneCards | GC0XM070752. |
| H-InvDB | HIX0016864. |
| HGNC | HGNC:4540. CXCR3. |
| HPA | CAB017820. |
| MIM | 300574. gene. |
| neXtProt | NX_P49682. |
| PharmGKB | PA35049. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10180. |
| GeneTree | ENSGT00590000082948. |
| HOVERGEN | HBG106917. |
| OMA | GYMHCCL. |
| PhylomeDB | P49682. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | P49682. |
| Bgee | P49682. |
| CleanEx | HS_CXCR3. |
| Genevestigator | P49682. |
| GermOnline | ENSG00000186810. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000276. 7TM_GPCR_Rhodpsn. IPR004070. Chemokine_CXCR3. IPR000355. Chemokine_rcpt. IPR017452. GPCR_Rhodpsn_supfam. [Graphical view] |
| KO | K04188. |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR00657. CCCHEMOKINER. PR01532. CXCCHMKINER3. PR00237. GPCRRHODOPSN. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 11181. |
| SOURCE | Search... |
Entry information
| Entry name | CXCR3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P49682 Secondary accession number(s): O15185 Q9P2T5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with