Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Caspase-4

Gene

CASP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Inflammatory caspase (PubMed:7797510, PubMed:23516580, PubMed:25119034). Essential effector of NLRP3 inflammasome-dependent CASP1 activation and IL1B and IL18 secretion in response to non-canonical activators, such as UVB radiation, cholera enterotoxin subunit B and cytosolic LPS (PubMed:22246630, PubMed:26174085, PubMed:26173988, PubMed:26508369, PubMed:25964352). Independently of NLRP3 inflammasome and CASP1, promotes pyroptosis, through GSDMD cleavage and activation, and IL1A, IL18 and HMGB1 release in response to non-canonical inflammasome activators (PubMed:24879791, PubMed:25964352). Plays a crucial role in the restriction of Salmonella typhimurium replication in colonic epithelial cells during infection (PubMed:25121752). In later stages of the infection, LPS from cytosolic Salmonella triggers CASP4 activation, which ultimately results in pyroptosis of infected cells and their extrusion into the gut lumen, as well as in IL18 secretion. Pyroptosis limits bacterial replication, while cytokine secretion promotes the recruitment and activation of immune cells and triggers mucosal inflammation. Involved in LPS-induced IL6 secretion; this activity may not require caspase enzymatic activity (PubMed:26508369). Involved in cell death induced by endoplasmic reticulum stress and by treatment with cytotoxic APP peptides found Alzheimer's patient brains (PubMed:15123740, PubMed:22246630, PubMed:23661706). Activated by direct binding to LPS without the need of an upstream sensor (PubMed:25119034). Does not directly process IL1B (PubMed:7743998, PubMed:7797592, PubMed:7797510).14 Publications

Catalytic activityi

Strict requirement for Asp at the P1 position. It has a preferred cleavage sequence of Tyr-Val-Ala-Asp-|- but also cleaves at Asp-Glu-Val-Asp-|-.1 Publication

Enzyme regulationi

Activated by homooligomerization induced by direct binding to cytosolic LPS, in a TLR4-independent manner (PubMed:25119034).1 Publication
(Microbial infection) Inhibited by the effector protein NleF produced by pathogenic E.coli; this inhibits apoptosis (PubMed:23516580).1 Publication

Kineticsi

Values obtained using the partial C-terminal enzyme sequence of 105-377.1 Publication

  1. KM=681 µM for synthetic peptide acetyl-YVAD-p-nitroanilide1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei210 – 2101By similarity
    Active sitei258 – 25814 Publications

    GO - Molecular functioni

    GO - Biological processi

    • apoptotic process Source: ProtInc
    • cellular response to beta-amyloid Source: ParkinsonsUK-UCL
    • inflammatory response Source: UniProtKB-KW
    • innate immune response Source: UniProtKB-KW
    • intrinsic apoptotic signaling pathway Source: ParkinsonsUK-UCL
    • intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress Source: ParkinsonsUK-UCL
    • proteolysis Source: ProtInc
    • regulation of apoptotic process Source: InterPro
    • regulation of inflammatory response Source: GO_Central
    Complete GO annotation...

    Keywords - Molecular functioni

    Hydrolase, Protease, Thiol protease

    Keywords - Biological processi

    Immunity, Inflammatory response, Innate immunity, Necrosis

    Enzyme and pathway databases

    BRENDAi3.4.22.57. 2681.
    ReactomeiR-HSA-168638. NOD1/2 Signaling Pathway.
    SABIO-RKP49662.

    Protein family/group databases

    MEROPSiC14.007.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Caspase-4 (EC:3.4.22.571 Publication)
    Short name:
    CASP-4
    Alternative name(s):
    ICE and Ced-3 homolog 21 Publication
    Short name:
    ICH-21 Publication
    ICE(rel)-II1 Publication
    Mih11 Publication
    Protease TX1 Publication
    Cleaved into the following 2 chains:
    Gene namesi
    Name:CASP4
    Synonyms:ICH2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:1505. CASP4.

    Subcellular locationi

    GO - Cellular componenti

    • AIM2 inflammasome complex Source: GO_Central
    • endoplasmic reticulum Source: ParkinsonsUK-UCL
    • endoplasmic reticulum membrane Source: UniProtKB-SubCell
    • extracellular region Source: UniProtKB-SubCell
    • IPAF inflammasome complex Source: GO_Central
    • mitochondrion Source: ParkinsonsUK-UCL
    • NLRP3 inflammasome complex Source: GO_Central
    Complete GO annotation...

    Keywords - Cellular componenti

    Cytoplasm, Endoplasmic reticulum, Inflammasome, Membrane, Mitochondrion, Secreted

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi258 – 2581C → A: Loss of enzymatic activity. Loss of LPS-induced pyroptosis. No effect on the interaction with LPS. Decrease in cell death induced by TMEM214 overexpression. Does not support IL1B and IL18 secretion following UVB irradiation. 3 Publications
    Mutagenesisi258 – 2581C → S: Loss of autocatalysis. 1 Publication

    Organism-specific databases

    PharmGKBiPA26088.

    Chemistry

    ChEMBLiCHEMBL2226.
    GuidetoPHARMACOLOGYi1620.

    Polymorphism and mutation databases

    BioMutaiCASP4.
    DMDMi1352420.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Propeptidei1 – ?8080Sequence analysisPRO_0000004596Add
    BLAST
    Chaini?81 – 270190Caspase-4 subunit 1PRO_0000004597Add
    BLAST
    Propeptidei271 – 28919Sequence analysis1 PublicationPRO_0000004598Add
    BLAST
    Chaini290 – 37788Caspase-4 subunit 2PRO_0000004599Add
    BLAST
    Isoform 2 (identifier: P49662-2)
    Initiator methionineiRemovedCombined sourcesCurated

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei83 – 831PhosphoserineCombined sources
    Isoform 2 (identifier: P49662-2)
    Modified residuei2 – 21N-acetylalanineCombined sourcesCurated

    Post-translational modificationi

    In response to activation signals, including endoplasmic reticulum stress or treatment with amyloid beta A4 protein fragments (such as beta-amyloid protein 40), undergoes autoproteolytic cleavage.3 Publications

    Keywords - PTMi

    Acetylation, Phosphoprotein, Zymogen

    Proteomic databases

    EPDiP49662.
    MaxQBiP49662.
    PaxDbiP49662.
    PeptideAtlasiP49662.
    PRIDEiP49662.

    PTM databases

    iPTMnetiP49662.
    PhosphoSiteiP49662.

    Expressioni

    Tissue specificityi

    Widely expressed, including in keratinocytes and colonic and small intestinal epithelial cells (at protein level). Not detected in brain.6 Publications

    Inductioni

    In peripheral blood mononuclear cells and purified monocytes, up-regulated by bacterial lipopolysaccharides (LPS) and interferon-beta/IFNB1 at the mRNA level (PubMed:16893518, PubMed:24879791). However, this increase is not observed at the protein level, which remains constant in monocytes and other cell types following LPS treatment (PubMed:25121752) (PubMed:26508369). In monocyte-derived macrophages, some up-regulation at the protein level is observed following treatment with LPS and IFNB1 (PubMed:25964352). In SH-EP1 neuroblastoma cell line, up-regulated by NF-kappa-B RELA/p65 at both mRNA and protein levels.3 Publications

    Gene expression databases

    BgeeiENSG00000196954.
    CleanExiHS_CASP4.
    ExpressionAtlasiP49662. baseline and differential.
    GenevisibleiP49662. HS.

    Organism-specific databases

    HPAiCAB037167.
    HPA027588.

    Interactioni

    Subunit structurei

    Upon direct LPS-binding, forms large homooligomers, resulting in its activation. These oligomers are often referred to as 'non-canonical inflammasomes' (PubMed:25119034). Active as a heterotetramer consisting of two anti-parallel arranged heterodimers, each one formed by a small and a large subunit (By similarity). In its precursor form, interacts with TMEM214; this interaction is required for association with the endoplasmic reticulum membrane (PubMed:23661706). Interacts with CASP1 (PubMed:22246630). Interacts with NOD2 (PubMed:18511561).By similarity4 Publications
    (Microbial infection) Interacts with NleF protein from pathogenic E.coli; this interaction leads to enzyme inhibition.1 Publication

    Protein-protein interaction databases

    BioGridi107287. 34 interactions.
    DIPiDIP-44806N.
    IntActiP49662. 3 interactions.
    MINTiMINT-1533864.
    STRINGi9606.ENSP00000388566.

    Chemistry

    BindingDBiP49662.

    Structurei

    3D structure databases

    ProteinModelPortaliP49662.
    SMRiP49662. Positions 99-377.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 9191CARDPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 5959Required for LPS-bindingBy similarityAdd
    BLAST

    Domaini

    The CARD domain mediates LPS recognition and homooligomerization.1 Publication

    Sequence similaritiesi

    Belongs to the peptidase C14A family.Curated
    Contains 1 CARD domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiKOG3573. Eukaryota.
    ENOG410ZQIE. LUCA.
    GeneTreeiENSGT00760000118912.
    HOGENOMiHOG000234399.
    HOVERGENiHBG076981.
    InParanoidiP49662.
    KOiK04394.
    OMAiRAKAQMP.
    OrthoDBiEOG091G07NO.
    PhylomeDBiP49662.
    TreeFamiTF102023.

    Family and domain databases

    Gene3Di1.10.533.10. 1 hit.
    3.40.50.1460. 1 hit.
    InterProiIPR001315. CARD.
    IPR029030. Caspase-like_dom.
    IPR033139. Caspase_cys_AS.
    IPR016129. Caspase_his_AS.
    IPR011029. DEATH-like_dom.
    IPR002138. Pept_C14_p10.
    IPR001309. Pept_C14_p20.
    IPR015917. Pept_C14A.
    [Graphical view]
    PfamiPF00619. CARD. 1 hit.
    [Graphical view]
    PRINTSiPR00376. IL1BCENZYME.
    SMARTiSM00114. CARD. 1 hit.
    SM00115. CASc. 1 hit.
    [Graphical view]
    SUPFAMiSSF47986. SSF47986. 1 hit.
    SSF52129. SSF52129. 1 hit.
    PROSITEiPS50209. CARD. 1 hit.
    PS01122. CASPASE_CYS. 1 hit.
    PS01121. CASPASE_HIS. 1 hit.
    PS50207. CASPASE_P10. 1 hit.
    PS50208. CASPASE_P20. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: P49662-1) [UniParc]FASTAAdd to basket
    Also known as: Alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MAEGNHRKKP LKVLESLGKD FLTGVLDNLV EQNVLNWKEE EKKKYYDAKT
    60 70 80 90 100
    EDKVRVMADS MQEKQRMAGQ MLLQTFFNID QISPNKKAHP NMEAGPPESG
    110 120 130 140 150
    ESTDALKLCP HEEFLRLCKE RAEEIYPIKE RNNRTRLALI ICNTEFDHLP
    160 170 180 190 200
    PRNGADFDIT GMKELLEGLD YSVDVEENLT ARDMESALRA FATRPEHKSS
    210 220 230 240 250
    DSTFLVLMSH GILEGICGTV HDEKKPDVLL YDTIFQIFNN RNCLSLKDKP
    260 270 280 290 300
    KVIIVQACRG ANRGELWVRD SPASLEVASS QSSENLEEDA VYKTHVEKDF
    310 320 330 340 350
    IAFCSSTPHN VSWRDSTMGS IFITQLITCF QKYSWCCHLE EVFRKVQQSF
    360 370
    ETPRAKAQMP TIERLSMTRY FYLFPGN
    Length:377
    Mass (Da):43,262
    Last modified:February 1, 1996 - v1
    Checksum:iDC7CCEC6E9D483EB
    GO
    Isoform 2 (identifier: P49662-2) [UniParc]FASTAAdd to basket
    Also known as: Gamma, mih1-beta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-56: Missing.

    Show »
    Length:321
    Mass (Da):36,705
    Checksum:i7336654FD603B65A
    GO
    Isoform 3 (identifier: P49662-3) [UniParc]FASTAAdd to basket
    Also known as: mih1-delta

    The sequence of this isoform differs from the canonical sequence as follows:
         88-116: AHPNMEAGPPESGESTDALKLCPHEEFLR → GDKLGHRGRNHNLCSAISCSSSEYGGWTT
         117-377: Missing.

    Note: May be due to competing acceptor splice site. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
    Show »
    Length:116
    Mass (Da):13,264
    Checksum:iFD9ED1FF1DF981D3
    GO
    Isoform 4 (identifier: P49662-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         261-263: ANR → GEC
         264-377: Missing.

    Note: No experimental confirmation available.Curated
    Show »
    Length:263
    Mass (Da):30,000
    Checksum:iFED10278B701F0F0
    GO
    Isoform 5 (identifier: P49662-5) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         125-157: IYPIKERNNRTRLALIICNTEFDHLPPRNGADF → VLCYLYEIEKKEEISLLSFSAPFLTALNDWGWG
         158-377: Missing.

    Note: No experimental confirmation available.Curated
    Show »
    Length:157
    Mass (Da):18,111
    Checksum:i65936259DD31435E
    GO

    Sequence cautioni

    Isoform 2 : The sequence AAC99851 differs from that shown. Reason: Frameshift at position 19. Combined sourcesCurated
    The sequence AAC99854 differs from that shown. Reason: Erroneous translation. Erroneous CDS prediction.Curated
    The sequence EAW67050 differs from that shown. Reason: Erroneous gene model prediction. Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti47 – 471D → N.
    Corresponds to variant rs56226603 [ dbSNP | Ensembl ].
    VAR_061081
    Natural varianti134 – 1341R → C.1 Publication
    Corresponds to variant rs181090259 [ dbSNP | Ensembl ].
    VAR_075654
    Natural varianti284 – 2841E → D.
    Corresponds to variant rs55901059 [ dbSNP | Ensembl ].
    VAR_061082

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5656Missing in isoform 2. 1 PublicationVSP_043495Add
    BLAST
    Alternative sequencei88 – 11629AHPNM…EEFLR → GDKLGHRGRNHNLCSAISCS SSEYGGWTT in isoform 3. 1 PublicationVSP_058177Add
    BLAST
    Alternative sequencei117 – 377261Missing in isoform 3. 1 PublicationVSP_058178Add
    BLAST
    Alternative sequencei125 – 15733IYPIK…NGADF → VLCYLYEIEKKEEISLLSFS APFLTALNDWGWG in isoform 5. 1 PublicationVSP_058179Add
    BLAST
    Alternative sequencei158 – 377220Missing in isoform 5. 1 PublicationVSP_058180Add
    BLAST
    Alternative sequencei261 – 2633ANR → GEC in isoform 4. 2 PublicationsVSP_058181
    Alternative sequencei264 – 377114Missing in isoform 4. 2 PublicationsVSP_058182Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    Z48810 mRNA. Translation: CAA88750.1.
    U28014 mRNA. Translation: AAA75171.1.
    U25804 mRNA. Translation: AAA86890.1.
    U28976 mRNA. Translation: AAC99850.1.
    U28977 mRNA. Translation: AAC99851.1. Frameshift.
    U28978 mRNA. Translation: AAC99852.1.
    U28979 mRNA. Translation: AAC99853.1.
    U28979 mRNA. Translation: AAC99854.1. Sequence problems.
    AK057094 mRNA. Translation: BAG51861.1.
    AK296081 mRNA. Translation: BAG58837.1.
    AK304222 mRNA. Translation: BAG65094.1.
    EF636667 Genomic DNA. Translation: ABR09278.1.
    AP001153 Genomic DNA. No translation available.
    AP002004 Genomic DNA. No translation available.
    CH471065 Genomic DNA. Translation: EAW67050.1. Sequence problems.
    CH471065 Genomic DNA. Translation: EAW67051.1.
    CH471065 Genomic DNA. Translation: EAW67052.1.
    BC017839 mRNA. Translation: AAH17839.1.
    AL050391 mRNA. Translation: CAB43686.2.
    CCDSiCCDS41704.1. [P49662-2]
    CCDS8327.1. [P49662-1]
    PIRiA57511.
    RefSeqiNP_001216.1. NM_001225.3. [P49662-1]
    NP_150649.1. NM_033306.2. [P49662-2]
    XP_011541321.1. XM_011543019.1.
    UniGeneiHs.138378.

    Genome annotation databases

    EnsembliENST00000393150; ENSP00000376857; ENSG00000196954. [P49662-2]
    ENST00000444739; ENSP00000388566; ENSG00000196954. [P49662-1]
    GeneIDi837.
    KEGGihsa:837.
    UCSCiuc001pib.2. human. [P49662-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    Z48810 mRNA. Translation: CAA88750.1.
    U28014 mRNA. Translation: AAA75171.1.
    U25804 mRNA. Translation: AAA86890.1.
    U28976 mRNA. Translation: AAC99850.1.
    U28977 mRNA. Translation: AAC99851.1. Frameshift.
    U28978 mRNA. Translation: AAC99852.1.
    U28979 mRNA. Translation: AAC99853.1.
    U28979 mRNA. Translation: AAC99854.1. Sequence problems.
    AK057094 mRNA. Translation: BAG51861.1.
    AK296081 mRNA. Translation: BAG58837.1.
    AK304222 mRNA. Translation: BAG65094.1.
    EF636667 Genomic DNA. Translation: ABR09278.1.
    AP001153 Genomic DNA. No translation available.
    AP002004 Genomic DNA. No translation available.
    CH471065 Genomic DNA. Translation: EAW67050.1. Sequence problems.
    CH471065 Genomic DNA. Translation: EAW67051.1.
    CH471065 Genomic DNA. Translation: EAW67052.1.
    BC017839 mRNA. Translation: AAH17839.1.
    AL050391 mRNA. Translation: CAB43686.2.
    CCDSiCCDS41704.1. [P49662-2]
    CCDS8327.1. [P49662-1]
    PIRiA57511.
    RefSeqiNP_001216.1. NM_001225.3. [P49662-1]
    NP_150649.1. NM_033306.2. [P49662-2]
    XP_011541321.1. XM_011543019.1.
    UniGeneiHs.138378.

    3D structure databases

    ProteinModelPortaliP49662.
    SMRiP49662. Positions 99-377.
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi107287. 34 interactions.
    DIPiDIP-44806N.
    IntActiP49662. 3 interactions.
    MINTiMINT-1533864.
    STRINGi9606.ENSP00000388566.

    Chemistry

    BindingDBiP49662.
    ChEMBLiCHEMBL2226.
    GuidetoPHARMACOLOGYi1620.

    Protein family/group databases

    MEROPSiC14.007.

    PTM databases

    iPTMnetiP49662.
    PhosphoSiteiP49662.

    Polymorphism and mutation databases

    BioMutaiCASP4.
    DMDMi1352420.

    Proteomic databases

    EPDiP49662.
    MaxQBiP49662.
    PaxDbiP49662.
    PeptideAtlasiP49662.
    PRIDEiP49662.

    Protocols and materials databases

    DNASUi837.
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000393150; ENSP00000376857; ENSG00000196954. [P49662-2]
    ENST00000444739; ENSP00000388566; ENSG00000196954. [P49662-1]
    GeneIDi837.
    KEGGihsa:837.
    UCSCiuc001pib.2. human. [P49662-1]

    Organism-specific databases

    CTDi837.
    GeneCardsiCASP4.
    HGNCiHGNC:1505. CASP4.
    HPAiCAB037167.
    HPA027588.
    MIMi602664. gene.
    neXtProtiNX_P49662.
    PharmGKBiPA26088.
    GenAtlasiSearch...

    Phylogenomic databases

    eggNOGiKOG3573. Eukaryota.
    ENOG410ZQIE. LUCA.
    GeneTreeiENSGT00760000118912.
    HOGENOMiHOG000234399.
    HOVERGENiHBG076981.
    InParanoidiP49662.
    KOiK04394.
    OMAiRAKAQMP.
    OrthoDBiEOG091G07NO.
    PhylomeDBiP49662.
    TreeFamiTF102023.

    Enzyme and pathway databases

    BRENDAi3.4.22.57. 2681.
    ReactomeiR-HSA-168638. NOD1/2 Signaling Pathway.
    SABIO-RKP49662.

    Miscellaneous databases

    ChiTaRSiCASP4. human.
    GenomeRNAii837.
    PROiP49662.
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSG00000196954.
    CleanExiHS_CASP4.
    ExpressionAtlasiP49662. baseline and differential.
    GenevisibleiP49662. HS.

    Family and domain databases

    Gene3Di1.10.533.10. 1 hit.
    3.40.50.1460. 1 hit.
    InterProiIPR001315. CARD.
    IPR029030. Caspase-like_dom.
    IPR033139. Caspase_cys_AS.
    IPR016129. Caspase_his_AS.
    IPR011029. DEATH-like_dom.
    IPR002138. Pept_C14_p10.
    IPR001309. Pept_C14_p20.
    IPR015917. Pept_C14A.
    [Graphical view]
    PfamiPF00619. CARD. 1 hit.
    [Graphical view]
    PRINTSiPR00376. IL1BCENZYME.
    SMARTiSM00114. CARD. 1 hit.
    SM00115. CASc. 1 hit.
    [Graphical view]
    SUPFAMiSSF47986. SSF47986. 1 hit.
    SSF52129. SSF52129. 1 hit.
    PROSITEiPS50209. CARD. 1 hit.
    PS01122. CASPASE_CYS. 1 hit.
    PS01121. CASPASE_HIS. 1 hit.
    PS50207. CASPASE_P10. 1 hit.
    PS50208. CASPASE_P20. 1 hit.
    [Graphical view]
    ProtoNetiSearch...

    Entry informationi

    Entry nameiCASP4_HUMAN
    AccessioniPrimary (citable) accession number: P49662
    Secondary accession number(s): A2NHL8
    , A2NHL9, A2NHM0, B3KPZ9, B4DJH5, B4E2D2, O95601, Q7KYX7, Q9UG96
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1996
    Last sequence update: February 1, 1996
    Last modified: September 7, 2016
    This is version 163 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Peptidase families
      Classification of peptidase families and list of entries
    6. SIMILARITY comments
      Index of protein domains and families

    Similar proteinsi

    Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
    100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
    90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
    50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.