P49589 (SYCC_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 124.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cysteine--tRNA ligase, cytoplasmic EC=6.1.1.16 Alternative name(s): Cysteinyl-tRNA synthetase Short name=CysRS | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 748 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys). |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Monomer By similarity. |
| Subcellular location | |
| Involvement in disease | A chromosomal aberration involving CARS is associated with inflammatory myofibroblastic tumors (IMTs). Translocation t(2;11)(p23;p15) with ALK. |
| Sequence similarities | Belongs to the class-I aminoacyl-tRNA synthetase family. |
| Sequence caution | The sequence AAA73901.1 differs from that shown. Reason: Frameshift at position 619. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P49589-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P49589-2) The sequence of this isoform differs from the canonical sequence as follows: 705-748: GLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ → VSMVCPHMTWRAKSSAKGKPRS | ||||||
| Note: Found in 20% of the mRNAs. | ||||||
| Isoform 3 (identifier: P49589-3) The sequence of this isoform differs from the canonical sequence as follows: 9-9: G → APDYRSILSI...KGQPCRLQAS | ||||||
| Note: Contains a phosphoserine at position 79. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 748 | 748 | Cysteine--tRNA ligase, cytoplasmic | PRO_0000159550 | |||||
Regions | |||||||||
| Motif | 57 – 67 | 11 | "HIGH" region | ||||||
| Motif | 406 – 410 | 5 | "KMSKS" region | ||||||
Sites | |||||||||
| Metal binding | 55 | 1 | Zinc By similarity | ||||||
| Metal binding | 348 | 1 | Zinc By similarity | ||||||
| Metal binding | 373 | 1 | Zinc By similarity | ||||||
| Metal binding | 377 | 1 | Zinc By similarity | ||||||
| Binding site | 409 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 307 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 503 | 1 | N6-acetyllysine Ref.12 | ||||||
| Modified residue | 746 | 1 | Phosphoserine Ref.11 Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 9 | 1 | G → APDYRSILSISDEAARAQAL NEHLSTRSYVQGYSLSQADV DAFRQLSAPPADPQLFHVAR WFRHIEALLGSPCGKGQPCR LQAS in isoform 3. | VSP_043571 | |||||
| Alternative sequence | 705 – 748 | 44 | GLPTH…NGSFQ → VSMVCPHMTWRAKSSAKGKP RS in isoform 2. | VSP_006312 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Nucleotide and deduced amino acid sequence of human cysteinyl-tRNA synthetase." Cruzen M.E., Arfin S.M. DNA Seq. 4:243-248(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "Isolation of two cDNAs encoding functional human cytoplasmic cysteinyl-tRNA synthetase." Davidson E., Caffarella J., Vitseva O., Hou Y.M., King M.P. Biol. Chem. 382:399-406(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Cervix. |
| [6] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [9] | "Identification of novel fusion partners of ALK, the anaplastic lymphoma kinase, in anaplastic large-cell lymphoma and inflammatory myofibroblastic tumor." Cools J., Wlodarska I., Somers R., Mentens N., Pedeutour F., Maes B., De Wolf-Peeters C., Pauwels P., Hagemeijer A., Marynen P. Genes Chromosomes Cancer 34:354-362(2002) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH ALK. |
| [10] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-746, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-503, MASS SPECTROMETRY. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-746, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-79 (ISOFORM 3), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L06845 mRNA. Translation: AAA73901.1. Frameshift. AF288206 mRNA. Translation: AAG00578.1. AF288207 mRNA. Translation: AAG00579.1. BT009913 mRNA. Translation: AAP88915.1. AK302644 mRNA. Translation: BAG63885.1. BX647906 mRNA. Translation: CAI46108.1. AC108448 Genomic DNA. No translation available. AC131971 Genomic DNA. No translation available. CH471158 Genomic DNA. Translation: EAX02541.1. BC002880 mRNA. Translation: AAH02880.1. |
| IPI | IPI00027443. IPI00556365. IPI00939491. |
| RefSeq | NP_001014437.1. NM_001014437.2. NP_001742.1. NM_001751.5. NP_644802.1. NM_139273.3. |
| UniGene | Hs.274873. |
3D structure databases | |
| ProteinModelPortal | P49589. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P49589. 4 interactions. |
| STRING | 9606.ENSP00000369897. |
PTM databases | |
| PhosphoSite | P49589. |
Polymorphism databases | |
| DMDM | 20141641. |
Proteomic databases | |
| PaxDb | P49589. |
| PRIDE | P49589. |
Protocols and materials databases | |
| DNASU | 833. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000278224; ENSP00000278224; ENSG00000110619. ENST00000380525; ENSP00000369897; ENSG00000110619. ENST00000397111; ENSP00000380300; ENSG00000110619. |
| GeneID | 833. |
| KEGG | hsa:833. |
| UCSC | uc001lxf.3. human. uc001lxg.3. human. uc001lxh.3. human. |
Organism-specific databases | |
| CTD | 833. |
| GeneCards | GC11M003022. |
| H-InvDB | HIX0128660. |
| HGNC | HGNC:1493. CARS. |
| HPA | HPA002383. HPA002384. |
| MIM | 123859. gene. |
| neXtProt | NX_P49589. |
| PharmGKB | PA26079. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0215. |
| HOGENOM | HOG000245252. |
| HOVERGEN | HBG002089. |
| KO | K01883. |
| OMA | VARWFRH. |
| OrthoDB | EOG473PQS. |
| PhylomeDB | P49589. |
Enzyme and pathway databases | |
| Reactome | REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | P49589. |
| Bgee | P49589. |
| CleanEx | HS_CARS. |
| Genevestigator | P49589. |
| GermOnline | ENSG00000110619. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.50.620. 2 hits. |
| InterPro | IPR015803. Cys-tRNA-ligase. IPR024909. Cys-tRNA/MSH_ligase. IPR014729. Rossmann-like_a/b/a_fold. IPR009080. tRNAsynth_1a_anticodon-bd. [Graphical view] |
| PANTHER | PTHR10890. PTHR10890. 1 hit. |
| Pfam | PF01406. tRNA-synt_1e. 1 hit. [Graphical view] |
| PRINTS | PR00983. TRNASYNTHCYS. |
| SUPFAM | SSF47323. tRNAsyn_1a_bind. 1 hit. |
| TIGRFAMs | TIGR00435. cysS. 1 hit. |
| PROSITE | PS00178. AA_TRNA_LIGASE_I. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CARS. human. |
| DrugBank | DB00151. L-Cysteine. |
| GenomeRNAi | 833. |
| NextBio | 3450. |
| SOURCE | Search... |
Entry information
| Entry name | SYCC_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P49589 Secondary accession number(s): Q53XI8 Q9HD25 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Aminoacyl-tRNA synthetases List of aminoacyl-tRNA synthetase entries |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
