Reviewed,
UniProtKB/Swiss-Prot P49589 (SYCC_HUMAN)
Last modified
February 9, 2010.
Version 90.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Cysteinyl-tRNA synthetase, cytoplasmic EC=6.1.1.16 Alternative name(s): Cysteine--tRNA ligase Short name=CysRS | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 748 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys). |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Monomer By similarity. |
| Subcellular location | |
| Involvement in disease | A chromosomal aberration involving CARS is associated with inflammatory myofibroblastic tumors (IMTs). Translocation t(2;11)(p23;p15) with ALK. |
| Sequence similarities | Belongs to the class-I aminoacyl-tRNA synthetase family. |
| Sequence caution | The sequence AAA73901.1 differs from that shown. Reason: Frameshift at position 619. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein biosynthesis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement |
| Disease | Proto-oncogene |
| Ligand | ATP-binding Metal-binding Nucleotide-binding Zinc |
| Molecular function | Aminoacyl-tRNA synthetase Ligase |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cysteinyl-tRNA aminoacylation Inferred from direct assay. Source: UniProtKB |
| Cellular component | cytoplasm Ref.2 Non-traceable author statement. Source: UniProtKB cytosol Ref.2Inferred from Experiment. Source: Reactome |
| Molecular function | ATP binding Inferred from direct assay. Source: UniProtKB cysteine-tRNA ligase activity Ref.2Inferred from direct assay. Source: UniProtKB protein homodimerization activityInferred from direct assay. Source: UniProtKB tRNA binding Ref.1Inferred from direct assay. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P49589-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P49589-2) The sequence of this isoform differs from the canonical sequence as follows: 705-748: GLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ → VSMVCPHMTWRAKSSAKGKPRS | ||||||
| Note: Found in 20% of the mRNAs. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 748 | 748 | Cysteinyl-tRNA synthetase, cytoplasmic | PRO_0000159550 | |||||
Regions | |||||||||
| Motif | 57 – 67 | 11 | "HIGH" region | ||||||
| Motif | 406 – 410 | 5 | "KMSKS" region | ||||||
Sites | |||||||||
| Metal binding | 55 | 1 | Zinc By similarity | ||||||
| Metal binding | 348 | 1 | Zinc By similarity | ||||||
| Metal binding | 373 | 1 | Zinc By similarity | ||||||
| Metal binding | 377 | 1 | Zinc By similarity | ||||||
| Binding site | 409 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 19 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 260 | 1 | Phosphotyrosine Ref.6 | ||||||
| Modified residue | 307 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 503 | 1 | N6-acetyllysine Ref.10 | ||||||
| Modified residue | 746 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 705 – 748 | 44 | GLPTH…NGSFQ → VSMVCPHMTWRAKSSAKGKP RS in isoform 2. | VSP_006312 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Nucleotide and deduced amino acid sequence of human cysteinyl-tRNA synthetase." Cruzen M.E., Arfin S.M. DNA Seq. 4:243-248(1994) [PubMed: 7987009] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "Isolation of two cDNAs encoding functional human cytoplasmic cysteinyl-tRNA synthetase." Davidson E., Caffarella J., Vitseva O., Hou Y.M., King M.P. Biol. Chem. 382:399-406(2001) [PubMed: 11347887] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [5] | "Identification of novel fusion partners of ALK, the anaplastic lymphoma kinase, in anaplastic large-cell lymphoma and inflammatory myofibroblastic tumor." Cools J., Wlodarska I., Somers R., Mentens N., Pedeutour F., Maes B., De Wolf-Peeters C., Pauwels P., Hagemeijer A., Marynen P. Genes Chromosomes Cancer 34:354-362(2002) [PubMed: 12112524] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH ALK. |
| [6] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-260, MASS SPECTROMETRY. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-746, MASS SPECTROMETRY. |
| [8] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [9] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19, MASS SPECTROMETRY. |
| [10] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-503, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L06845 mRNA. Translation: AAA73901.1. Frameshift. AF288206 mRNA. Translation: AAG00578.1. AF288207 mRNA. Translation: AAG00579.1. BT009913 mRNA. Translation: AAP88915.1. BC002880 mRNA. Translation: AAH02880.1. |
| IPI | IPI00556365. IPI00939491. |
| RefSeq | NP_001742.1. NP_644802.1. |
| UniGene | Hs.274873 |
3D structure databases | |
| SMR | P49589. Positions 29-564. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P49589. |
PTM databases | |
| PhosphoSite | P49589. |
Proteomic databases | |
| PRIDE | P49589. |
Genome annotation databases | |
| Ensembl | ENST00000397111; ENSP00000380300; ENSG00000110619; Homo sapiens. [Genome view] |
| GeneID | 833. |
| NMPDR | fig|9606.3.peg.5048. |
| UCSC | uc001lxg.1. human. uc001lxh.1. human. |
Organism-specific databases | |
| CTD | 833. |
| GeneCards | GC11M002978. |
| HGNC | HGNC:1493. CARS. |
| HPA | HPA002383. HPA002384. |
| MIM | 123859. gene. |
| PharmGKB | PA26079. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG17865. |
| HOVERGEN | P49589. |
| PhylomeDB | P49589. |
Enzyme and pathway databases | |
| BRENDA | 6.1.1.16. 247. |
| Reactome | REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | P49589. |
| Bgee | P49589. |
| CleanEx | HS_CARS. |
| Genevestigator | P49589. |
| GermOnline | ENSG00000110619. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR015804. Cys-tRNA-synt_Ia_C. IPR015803. Cys-tRNA-synt_Ia_N. IPR002308. Cys-tRNA-synth_1a. IPR014729. Rossmann-like_a/b/a_fold. [Graphical view] |
| Gene3D | G3DSA:3.40.50.620. Rossmann-like_a/b/a_fold. 1 hit. |
| PANTHER | PTHR10890. Cys_tRNA-synt_1a. 1 hit. |
| Pfam | PF01406. tRNA-synt_1e. 1 hit. [Graphical view] |
| PRINTS | PR00983. TRNASYNTHCYS. |
| TIGRFAMs | TIGR00435. cysS. 1 hit. |
| PROSITE | PS00178. AA_TRNA_LIGASE_I. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| DrugBank | DB00151. L-Cysteine. |
| NextBio | 3450. |
| SOURCE | Search... |
Entry information
| Entry name | SYCC_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P49589 Secondary accession number(s): Q53XI8, Q9HD24, Q9HD25 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Aminoacyl-tRNA synthetases List of aminoacyl-tRNA synthetase entries |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


