Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Signal recognition particle 9 kDa protein

Gene

SRP9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.

GO - Molecular functioni

  • 7S RNA binding Source: InterPro
  • RNA binding Source: ProtInc
  • signal recognition particle binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000180581-MONOMER.
ReactomeiR-HSA-1799339. SRP-dependent cotranslational protein targeting to membrane.

Protein family/group databases

TCDBi3.A.5.9.1. the general secretory pathway (sec) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Signal recognition particle 9 kDa protein
Short name:
SRP9
Gene namesi
Name:SRP9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:11304. SRP9.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • signal recognition particle, endoplasmic reticulum targeting Source: UniProtKB
  • signal recognition particle receptor complex Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Signal recognition particle

Pathology & Biotechi

Organism-specific databases

DisGeNETi6726.
OpenTargetsiENSG00000143742.
PharmGKBiPA36128.

Polymorphism and mutation databases

BioMutaiSRP9.
DMDMi1351111.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00001351822 – 86Signal recognition particle 9 kDa proteinAdd BLAST85

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei52N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP49458.
MaxQBiP49458.
PaxDbiP49458.
PeptideAtlasiP49458.
PRIDEiP49458.
TopDownProteomicsiP49458-1. [P49458-1]

PTM databases

iPTMnetiP49458.
PhosphoSitePlusiP49458.

Expressioni

Gene expression databases

BgeeiENSG00000143742.
CleanExiHS_SRP9.
ExpressionAtlasiP49458. baseline and differential.
GenevisibleiP49458. HS.

Interactioni

Subunit structurei

Signal recognition particle consists of a 7S RNA molecule of 300 nucleotides and six protein subunits: SRP72, SRP68, SRP54, SRP19, SRP14 and SRP9.1 Publication

Protein-protein interaction databases

BioGridi112604. 57 interactors.
DIPiDIP-6151N.
IntActiP49458. 23 interactors.
MINTiMINT-151380.
STRINGi9606.ENSP00000305230.

Structurei

Secondary structure

186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi3 – 6Combined sources4
Helixi7 – 20Combined sources14
Turni22 – 24Combined sources3
Beta strandi26 – 32Combined sources7
Turni33 – 36Combined sources4
Beta strandi37 – 43Combined sources7
Beta strandi48 – 53Combined sources6
Helixi57 – 73Combined sources17
Beta strandi75 – 77Combined sources3
Helixi78 – 80Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1E8OX-ray3.20A/C2-86[»]
1E8SX-ray4.00A2-86[»]
1RY1electron microscopy12.00C2-86[»]
4UYJX-ray3.35A/C1-85[»]
4UYKX-ray3.22A1-85[»]
5AOXX-ray2.04A/D2-86[»]
ProteinModelPortaliP49458.
SMRiP49458.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP49458.

Family & Domainsi

Sequence similaritiesi

Belongs to the SRP9 family.Curated

Phylogenomic databases

eggNOGiKOG3465. Eukaryota.
ENOG41123E8. LUCA.
GeneTreeiENSGT00390000018505.
HOGENOMiHOG000283871.
HOVERGENiHBG055306.
InParanoidiP49458.
KOiK03109.
OMAiVCLQYKT.
OrthoDBiEOG091G15XS.
PhylomeDBiP49458.
TreeFamiTF106246.

Family and domain databases

Gene3Di3.30.720.10. 1 hit.
InterProiIPR008832. Signal_recog_particle_SRP9.
IPR009018. Signal_recog_particle_SRP9/14.
[Graphical view]
PIRSFiPIRSF017029. Signal_recog_particle_SRP9. 1 hit.
SUPFAMiSSF54762. SSF54762. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P49458-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPQYQTWEEF SRAAEKLYLA DPMKARVVLK YRHSDGNLCV KVTDDLVCLV
60 70 80
YKTDQAQDVK KIEKFHSQLM RLMVAKEARN VTMETE
Length:86
Mass (Da):10,112
Last modified:January 23, 2007 - v2
Checksum:iDB2CA071AF0E6F65
GO
Isoform 2 (identifier: P49458-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-86: CLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE → RQCLALLLRLQCSGMIIAHCILDLLGSSGPLASAS

Show »
Length:82
Mass (Da):9,124
Checksum:iD4C817FE1A6D7ED5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: P49458-2)
Sequence conflicti64I → M in AAH21995 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04127048 – 86CLVYK…TMETE → RQCLALLLRLQCSGMIIAHC ILDLLGSSGPLASAS in isoform 2. 2 PublicationsAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20998 mRNA. Translation: AAA70170.1.
EF488978 mRNA. Translation: ABP02070.1.
AK289595 mRNA. Translation: BAF82284.1.
CH471066 Genomic DNA. Translation: EAW50106.1.
CH471098 Genomic DNA. Translation: EAW69750.1.
CH471098 Genomic DNA. Translation: EAW69751.1.
BC008443 mRNA. Translation: AAH08443.1.
BC067845 mRNA. Translation: AAH67845.1.
BC021995 mRNA. Translation: AAH21995.1.
BC015094 mRNA. Translation: AAH15094.1.
BC022415 mRNA. Translation: AAH22415.1.
BC066957 mRNA. Translation: AAH66957.1.
CCDSiCCDS1546.1. [P49458-1]
CCDS44323.1. [P49458-2]
PIRiA57292.
RefSeqiNP_001123912.1. NM_001130440.1. [P49458-2]
NP_003124.1. NM_003133.5. [P49458-1]
UniGeneiHs.511425.
Hs.706900.

Genome annotation databases

EnsembliENST00000304786; ENSP00000305230; ENSG00000143742. [P49458-1]
ENST00000366839; ENSP00000355804; ENSG00000143742. [P49458-2]
ENST00000619790; ENSP00000485002; ENSG00000143742. [P49458-2]
GeneIDi6726.
KEGGihsa:6726.
UCSCiuc001hpg.4. human. [P49458-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Wikipedia

Signal recognition particle entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U20998 mRNA. Translation: AAA70170.1.
EF488978 mRNA. Translation: ABP02070.1.
AK289595 mRNA. Translation: BAF82284.1.
CH471066 Genomic DNA. Translation: EAW50106.1.
CH471098 Genomic DNA. Translation: EAW69750.1.
CH471098 Genomic DNA. Translation: EAW69751.1.
BC008443 mRNA. Translation: AAH08443.1.
BC067845 mRNA. Translation: AAH67845.1.
BC021995 mRNA. Translation: AAH21995.1.
BC015094 mRNA. Translation: AAH15094.1.
BC022415 mRNA. Translation: AAH22415.1.
BC066957 mRNA. Translation: AAH66957.1.
CCDSiCCDS1546.1. [P49458-1]
CCDS44323.1. [P49458-2]
PIRiA57292.
RefSeqiNP_001123912.1. NM_001130440.1. [P49458-2]
NP_003124.1. NM_003133.5. [P49458-1]
UniGeneiHs.511425.
Hs.706900.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1E8OX-ray3.20A/C2-86[»]
1E8SX-ray4.00A2-86[»]
1RY1electron microscopy12.00C2-86[»]
4UYJX-ray3.35A/C1-85[»]
4UYKX-ray3.22A1-85[»]
5AOXX-ray2.04A/D2-86[»]
ProteinModelPortaliP49458.
SMRiP49458.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112604. 57 interactors.
DIPiDIP-6151N.
IntActiP49458. 23 interactors.
MINTiMINT-151380.
STRINGi9606.ENSP00000305230.

Protein family/group databases

TCDBi3.A.5.9.1. the general secretory pathway (sec) family.

PTM databases

iPTMnetiP49458.
PhosphoSitePlusiP49458.

Polymorphism and mutation databases

BioMutaiSRP9.
DMDMi1351111.

Proteomic databases

EPDiP49458.
MaxQBiP49458.
PaxDbiP49458.
PeptideAtlasiP49458.
PRIDEiP49458.
TopDownProteomicsiP49458-1. [P49458-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304786; ENSP00000305230; ENSG00000143742. [P49458-1]
ENST00000366839; ENSP00000355804; ENSG00000143742. [P49458-2]
ENST00000619790; ENSP00000485002; ENSG00000143742. [P49458-2]
GeneIDi6726.
KEGGihsa:6726.
UCSCiuc001hpg.4. human. [P49458-1]

Organism-specific databases

CTDi6726.
DisGeNETi6726.
GeneCardsiSRP9.
HGNCiHGNC:11304. SRP9.
MIMi600707. gene.
neXtProtiNX_P49458.
OpenTargetsiENSG00000143742.
PharmGKBiPA36128.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3465. Eukaryota.
ENOG41123E8. LUCA.
GeneTreeiENSGT00390000018505.
HOGENOMiHOG000283871.
HOVERGENiHBG055306.
InParanoidiP49458.
KOiK03109.
OMAiVCLQYKT.
OrthoDBiEOG091G15XS.
PhylomeDBiP49458.
TreeFamiTF106246.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000180581-MONOMER.
ReactomeiR-HSA-1799339. SRP-dependent cotranslational protein targeting to membrane.

Miscellaneous databases

ChiTaRSiSRP9. human.
EvolutionaryTraceiP49458.
GenomeRNAii6726.
PROiP49458.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143742.
CleanExiHS_SRP9.
ExpressionAtlasiP49458. baseline and differential.
GenevisibleiP49458. HS.

Family and domain databases

Gene3Di3.30.720.10. 1 hit.
InterProiIPR008832. Signal_recog_particle_SRP9.
IPR009018. Signal_recog_particle_SRP9/14.
[Graphical view]
PIRSFiPIRSF017029. Signal_recog_particle_SRP9. 1 hit.
SUPFAMiSSF54762. SSF54762. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSRP09_HUMAN
AccessioniPrimary (citable) accession number: P49458
Secondary accession number(s): A8K0N0, Q6NVX0, Q8WTW0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: January 23, 2007
Last modified: November 2, 2016
This is version 166 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.