Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein farnesyltransferase subunit beta

Gene

FNTB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.5 Publications

Catalytic activityi

Farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.5 Publications

Cofactori

Zn2+6 PublicationsNote: Binds 1 zinc ion per subunit.6 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei102Important for selectivity against geranylgeranyl diphosphate1
Metal bindingi297Zinc; catalytic1
Metal bindingi299Zinc; catalytic1
Metal bindingi362Zinc; via tele nitrogen; catalytic1

GO - Molecular functioni

  • drug binding Source: Ensembl
  • farnesyltranstransferase activity Source: Ensembl
  • isoprenoid binding Source: Ensembl
  • peptide binding Source: Ensembl
  • protein farnesyltransferase activity Source: UniProtKB
  • zinc ion binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Prenyltransferase, Transferase

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000125954-MONOMER.
ReactomeiR-HSA-2514859. Inactivation, recovery and regulation of the phototransduction cascade.
SIGNORiP49356.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein farnesyltransferase subunit beta (EC:2.5.1.58)
Short name:
FTase-beta
Alternative name(s):
CAAX farnesyltransferase subunit beta
Ras proteins prenyltransferase subunit beta
Gene namesi
Name:FNTB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:3785. FNTB.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: Reactome
  • microtubule associated complex Source: BHF-UCL
  • protein farnesyltransferase complex Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi102W → T: Removes the steric hindrance that normally precludes geranylgeranyl diphosphate binding. Reduces farnesyltransferase activity and confers geranylgeranyltransferase activity. 1 Publication1
Mutagenesisi200D → N: Reduced catalytic efficiency. 1 Publication1
Mutagenesisi249G → V: Reduced catalytic efficiency. 1 Publication1
Mutagenesisi349G → S: Reduced catalytic efficiency. 1 Publication1

Organism-specific databases

DisGeNETi2342.
OpenTargetsiENSG00000257365.
PharmGKBiPA28202.

Chemistry databases

ChEMBLiCHEMBL272.
GuidetoPHARMACOLOGYi2826.

Polymorphism and mutation databases

BioMutaiFNTB.
DMDMi1346696.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001197611 – 437Protein farnesyltransferase subunit betaAdd BLAST437

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei436PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP49356.
MaxQBiP49356.
PaxDbiP49356.
PeptideAtlasiP49356.
PRIDEiP49356.

PTM databases

iPTMnetiP49356.
PhosphoSitePlusiP49356.

Expressioni

Gene expression databases

BgeeiENSG00000257365.
CleanExiHS_FNTB.
GenevisibleiP49356. HS.

Organism-specific databases

HPAiHPA062743.

Interactioni

Subunit structurei

Heterodimer of FNTA and FNTB.7 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
FNTAP4935411EBI-602349,EBI-602336

Protein-protein interaction databases

BioGridi108627. 49 interactors.
1529403. 1 interactor.
IntActiP49356. 2 interactors.
MINTiMINT-238879.
STRINGi9606.ENSP00000246166.

Chemistry databases

BindingDBiP49356.

Structurei

Secondary structure

1437
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi24 – 26Combined sources3
Helixi28 – 33Combined sources6
Helixi43 – 60Combined sources18
Helixi75 – 85Combined sources11
Beta strandi87 – 89Combined sources3
Helixi91 – 96Combined sources6
Helixi100 – 113Combined sources14
Helixi120 – 133Combined sources14
Beta strandi138 – 143Combined sources6
Helixi150 – 163Combined sources14
Helixi166 – 169Combined sources4
Helixi174 – 182Combined sources9
Beta strandi191 – 194Combined sources4
Helixi201 – 213Combined sources13
Turni219 – 224Combined sources6
Helixi225 – 232Combined sources8
Beta strandi237 – 239Combined sources3
Helixi249 – 262Combined sources14
Helixi265 – 267Combined sources3
Helixi270 – 279Combined sources10
Turni283 – 285Combined sources3
Beta strandi287 – 291Combined sources5
Helixi300 – 303Combined sources4
Turni304 – 306Combined sources3
Helixi307 – 317Combined sources11
Beta strandi325 – 327Combined sources3
Helixi332 – 342Combined sources11
Helixi360 – 374Combined sources15
Beta strandi375 – 378Combined sources4
Beta strandi381 – 384Combined sources4
Helixi390 – 392Combined sources3
Turni399 – 401Combined sources3
Helixi405 – 416Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JCQX-ray2.30B1-437[»]
1LD7X-ray2.00B1-437[»]
1LD8X-ray1.80B1-437[»]
1MZCX-ray2.00B1-437[»]
1S63X-ray1.90B1-437[»]
1SA4X-ray2.10B1-437[»]
1TN6X-ray1.80B1-437[»]
2F0YX-ray2.70B1-437[»]
2H6FX-ray1.50B1-437[»]
2H6GX-ray1.85B1-437[»]
2H6HX-ray1.80B1-437[»]
2H6IX-ray3.00B1-437[»]
2IEJX-ray1.80B1-437[»]
3E37X-ray1.80B1-437[»]
ProteinModelPortaliP49356.
SMRiP49356.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP49356.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati123 – 164PFTB 1Add BLAST42
Repeati174 – 215PFTB 2Add BLAST42
Repeati222 – 263PFTB 3Add BLAST42
Repeati270 – 312PFTB 4Add BLAST43
Repeati332 – 374PFTB 5Add BLAST43

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni248 – 251Farnesyl diphosphate binding4
Regioni291 – 294Farnesyl diphosphate binding4
Regioni300 – 303Farnesyl diphosphate binding4

Sequence similaritiesi

Contains 5 PFTB repeats.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0365. Eukaryota.
COG5029. LUCA.
GeneTreeiENSGT00550000075042.
HOVERGENiHBG008173.
InParanoidiP49356.
KOiK05954.
OMAiFMLRMKD.
OrthoDBiEOG091G08TB.
PhylomeDBiP49356.
TreeFamiTF353162.

Family and domain databases

CDDicd02893. FTase. 1 hit.
Gene3Di1.50.10.20. 1 hit.
InterProiIPR026872. FTB.
IPR001330. PFTB_repeat.
IPR008930. Terpenoid_cyclase/PrenylTrfase.
[Graphical view]
PANTHERiPTHR11774:SF6. PTHR11774:SF6. 1 hit.
PfamiPF00432. Prenyltrans. 5 hits.
[Graphical view]
SUPFAMiSSF48239. SSF48239. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P49356-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASPSSFTYY CPPSSSPVWS EPLYSLRPEH ARERLQDDSV ETVTSIEQAK
60 70 80 90 100
VEEKIQEVFS SYKFNHLVPR LVLQREKHFH YLKRGLRQLT DAYECLDASR
110 120 130 140 150
PWLCYWILHS LELLDEPIPQ IVATDVCQFL ELCQSPEGGF GGGPGQYPHL
160 170 180 190 200
APTYAAVNAL CIIGTEEAYD IINREKLLQY LYSLKQPDGS FLMHVGGEVD
210 220 230 240 250
VRSAYCAASV ASLTNIITPD LFEGTAEWIA RCQNWEGGIG GVPGMEAHGG
260 270 280 290 300
YTFCGLAALV ILKRERSLNL KSLLQWVTSR QMRFEGGFQG RCNKLVDGCY
310 320 330 340 350
SFWQAGLLPL LHRALHAQGD PALSMSHWMF HQQALQEYIL MCCQCPAGGL
360 370 380 390 400
LDKPGKSRDF YHTCYCLSGL SIAQHFGSGA MLHDVVLGVP ENALQPTHPV
410 420 430
YNIGPDKVIQ ATTYFLQKPV PGFEELKDET SAEPATD
Length:437
Mass (Da):48,774
Last modified:February 1, 1996 - v1
Checksum:i8E8E571846146709
GO
Isoform 2 (identifier: P49356-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQ → MI

Note: No experimental confirmation available.
Show »
Length:391
Mass (Da):43,574
Checksum:i00AC66972207B800
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti283R → L in AAA86286 (PubMed:8276393).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0546571 – 48MASPS…TSIEQ → MI in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L00635 mRNA. Translation: AAA35854.1.
AK303739 mRNA. Translation: BAG64712.1.
AK315714 mRNA. Translation: BAG38073.1.
AL135745 Genomic DNA. No translation available.
AL139022 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80897.1.
BC020232 mRNA. Translation: AAH20232.1.
L10414 mRNA. Translation: AAA86286.1.
CCDSiCCDS9769.1. [P49356-1]
PIRiB49274.
RefSeqiNP_001189487.1. NM_001202558.1. [P49356-2]
NP_002019.1. NM_002028.3. [P49356-1]
UniGeneiHs.325531.

Genome annotation databases

EnsembliENST00000246166; ENSP00000246166; ENSG00000257365. [P49356-1]
GeneIDi100529261.
2342.
KEGGihsa:100529261.
hsa:2342.
UCSCiuc001xia.4. human. [P49356-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L00635 mRNA. Translation: AAA35854.1.
AK303739 mRNA. Translation: BAG64712.1.
AK315714 mRNA. Translation: BAG38073.1.
AL135745 Genomic DNA. No translation available.
AL139022 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80897.1.
BC020232 mRNA. Translation: AAH20232.1.
L10414 mRNA. Translation: AAA86286.1.
CCDSiCCDS9769.1. [P49356-1]
PIRiB49274.
RefSeqiNP_001189487.1. NM_001202558.1. [P49356-2]
NP_002019.1. NM_002028.3. [P49356-1]
UniGeneiHs.325531.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JCQX-ray2.30B1-437[»]
1LD7X-ray2.00B1-437[»]
1LD8X-ray1.80B1-437[»]
1MZCX-ray2.00B1-437[»]
1S63X-ray1.90B1-437[»]
1SA4X-ray2.10B1-437[»]
1TN6X-ray1.80B1-437[»]
2F0YX-ray2.70B1-437[»]
2H6FX-ray1.50B1-437[»]
2H6GX-ray1.85B1-437[»]
2H6HX-ray1.80B1-437[»]
2H6IX-ray3.00B1-437[»]
2IEJX-ray1.80B1-437[»]
3E37X-ray1.80B1-437[»]
ProteinModelPortaliP49356.
SMRiP49356.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108627. 49 interactors.
1529403. 1 interactor.
IntActiP49356. 2 interactors.
MINTiMINT-238879.
STRINGi9606.ENSP00000246166.

Chemistry databases

BindingDBiP49356.
ChEMBLiCHEMBL272.
GuidetoPHARMACOLOGYi2826.

PTM databases

iPTMnetiP49356.
PhosphoSitePlusiP49356.

Polymorphism and mutation databases

BioMutaiFNTB.
DMDMi1346696.

Proteomic databases

EPDiP49356.
MaxQBiP49356.
PaxDbiP49356.
PeptideAtlasiP49356.
PRIDEiP49356.

Protocols and materials databases

DNASUi2342.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000246166; ENSP00000246166; ENSG00000257365. [P49356-1]
GeneIDi100529261.
2342.
KEGGihsa:100529261.
hsa:2342.
UCSCiuc001xia.4. human. [P49356-1]

Organism-specific databases

CTDi100529261.
2342.
DisGeNETi2342.
GeneCardsiFNTB.
HGNCiHGNC:3785. FNTB.
HPAiHPA062743.
MIMi134636. gene.
neXtProtiNX_P49356.
OpenTargetsiENSG00000257365.
PharmGKBiPA28202.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0365. Eukaryota.
COG5029. LUCA.
GeneTreeiENSGT00550000075042.
HOVERGENiHBG008173.
InParanoidiP49356.
KOiK05954.
OMAiFMLRMKD.
OrthoDBiEOG091G08TB.
PhylomeDBiP49356.
TreeFamiTF353162.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000125954-MONOMER.
ReactomeiR-HSA-2514859. Inactivation, recovery and regulation of the phototransduction cascade.
SIGNORiP49356.

Miscellaneous databases

EvolutionaryTraceiP49356.
GeneWikiiFNTB.
PROiP49356.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000257365.
CleanExiHS_FNTB.
GenevisibleiP49356. HS.

Family and domain databases

CDDicd02893. FTase. 1 hit.
Gene3Di1.50.10.20. 1 hit.
InterProiIPR026872. FTB.
IPR001330. PFTB_repeat.
IPR008930. Terpenoid_cyclase/PrenylTrfase.
[Graphical view]
PANTHERiPTHR11774:SF6. PTHR11774:SF6. 1 hit.
PfamiPF00432. Prenyltrans. 5 hits.
[Graphical view]
SUPFAMiSSF48239. SSF48239. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiFNTB_HUMAN
AccessioniPrimary (citable) accession number: P49356
Secondary accession number(s): B2RDX6, B4E1A0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: November 30, 2016
This is version 168 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.