P49282 (NRAM2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Natural resistance-associated macrophage protein 2 Short name=NRAMP 2 Alternative name(s): Divalent cation transporter 1 Divalent metal transporter 1 Short name=DMT-1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 568 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Important in metal transport, in particular iron. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution. Ref.8 Ref.9 |
| Subunit structure | Forms a complex with NDFIP1 and NEDD4L, in cortical neurons, in response to iron and colbalt exposure; this interaction leads to ubiquitination by NEDD4L and proteasome-dependent degradation. Interacts with NDFIP2 By similarity. |
| Subcellular location | Endosome membrane; Multi-pass membrane protein By similarity. |
| Tissue specificity | Isoform 2 is abundantly expressed in erythroid precursor cells (at protein level). Expressed at low levels in most tissues analyzed. Expressed at low levels in small intestine and at higher levels in kidney. Ref.7 Ref.8 |
| Induction | Isoform 1 is up-regulated under iron-depletion conditions in the proximal portion of the duodenum where it is abundantly expressed in the brush border of absorptive epithelial cells (at protein level). Ref.7 |
| Post-translational modification | Ubiquitinated by WWP2. Ref.11 |
| Involvement in disease | Defects in Slc11a2 are the cause of microcytic anemia (mk). Homozygous mk/mk mice have hypochromic microcytic anemia due to severe defects in intestinal iron absorption and erythroid iron utilization. |
| Disruption phenotype | Mice display no apparent anatomical abnormalities. They are however anemic, show progressive postnatal growth retardation, and at birth have elevated liver iron stores compared with wild-type littermates. None survive for more than 7 days. Heterozygotes appear normal, showing no significant hematological abnormalities. However, by 8 weeks, their liver iron content is lower than in wild-type littermates. Ref.9 |
| Miscellaneous | Nifedipine induces duodenal iron accumulation and mobilizes iron from the liver of iron-overloaded mice. |
| Sequence similarities | Belongs to the NRAMP family. |
| Sequence caution | The sequence CAD38518.1 differs from that shown. Reason: Frameshift at position 69. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: P49282-1) Also known as: Non-IRE; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P49282-2) Also known as: IRE; The sequence of this isoform differs from the canonical sequence as follows: 544-568: YRLGLTAQPELYLLNTVDADSVVSR → VSISKVLLSEDTSGGNIK | ||||||
| Isoform 3 (identifier: P49282-3) Also known as: 1A-IRE; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGKKQPRAAAAAPNCELKSYSKSTDPQVSTM 544-568: YRLGLTAQPELYLLNTVDADSVVSR → VSISKVLLSEDTSGGNIK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: P49282-4) Also known as: 1A-Non-IRE; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGKKQPRAAAAAPNCELKSYSKSTDPQVSTM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 568 | 568 | Natural resistance-associated macrophage protein 2 | PRO_0000212595 | |||||
Regions | |||||||||
| Topological domain | 1 – 69 | 69 | Cytoplasmic Potential | ||||||
| Transmembrane | 70 – 90 | 21 | Helical; Potential | ||||||
| Topological domain | 91 – 95 | 5 | Extracellular Potential | ||||||
| Transmembrane | 96 – 117 | 22 | Helical; Potential | ||||||
| Topological domain | 118 – 154 | 37 | Cytoplasmic Potential | ||||||
| Transmembrane | 155 – 175 | 21 | Helical; Potential | ||||||
| Topological domain | 176 – 179 | 4 | Extracellular Potential | ||||||
| Transmembrane | 180 – 194 | 15 | Helical; Potential | ||||||
| Topological domain | 195 – 208 | 14 | Cytoplasmic Potential | ||||||
| Transmembrane | 209 – 229 | 21 | Helical; Potential | ||||||
| Topological domain | 230 – 255 | 26 | Extracellular Potential | ||||||
| Transmembrane | 256 – 276 | 21 | Helical; Potential | ||||||
| Topological domain | 277 – 301 | 25 | Cytoplasmic Potential | ||||||
| Transmembrane | 302 – 322 | 21 | Helical; Potential | ||||||
| Topological domain | 323 – 360 | 38 | Extracellular Potential | ||||||
| Transmembrane | 361 – 381 | 21 | Helical; Potential | ||||||
| Topological domain | 382 – 408 | 27 | Cytoplasmic Potential | ||||||
| Transmembrane | 409 – 429 | 21 | Helical; Potential | ||||||
| Topological domain | 430 – 440 | 11 | Extracellular Potential | ||||||
| Transmembrane | 441 – 461 | 21 | Helical; Potential | ||||||
| Topological domain | 462 – 482 | 21 | Cytoplasmic Potential | ||||||
| Transmembrane | 483 – 503 | 21 | Helical; Potential | ||||||
| Topological domain | 504 – 506 | 3 | Extracellular Potential | ||||||
| Transmembrane | 507 – 527 | 21 | Helical; Potential | ||||||
| Topological domain | 528 – 568 | 41 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 21 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 564 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 567 | 1 | Phosphoserine Ref.12 | ||||||
| Glycosylation | 336 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 349 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MGKKQPRAAAAAPNCELKSY SKSTDPQVSTM in isoform 3 and isoform 4. | VSP_038145 | |||||
| Alternative sequence | 544 – 568 | 25 | YRLGL…SVVSR → VSISKVLLSEDTSGGNIK in isoform 1 and isoform 3. | VSP_003596 | |||||
| Natural variant | 185 | 1 | G → R in microcytic anemia. Ref.13 | ||||||
Experimental info | |||||||||
| Sequence conflict | 6 | 1 | K → E in BAE28454. Ref.3 | ||||||
| Sequence conflict | 6 | 1 | K → E in CAD38518. Ref.6 | ||||||
| Sequence conflict | 68 | 1 | R → S in AAC24496. Ref.2 | ||||||
| Sequence conflict | 69 – 70 | 2 | Missing in CAD38518. Ref.6 | ||||||
| Sequence conflict | 142 | 1 | P → R in BAC38930. Ref.3 | ||||||
| Sequence conflict | 182 | 1 | L → V in AAC42051. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of a second mouse Nramp gene." Gruenheid S., Cellier M., Vidal S., Gros P. Genomics 25:514-525(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Nramp2 is mutated in the anemic Belgrade (b) rat: evidence of a role for Nramp2 in endosomal iron transport." Fleming M.D., Romano M.A., Su M.A., Garrick L.M., Garrick M.D., Andrews N.C. Proc. Natl. Acad. Sci. U.S.A. 95:1148-1153(1998) Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: DBA. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Embryo and Hippocampus. |
| [4] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: FVB/N. Tissue: Kidney. |
| [6] | "Previously uncharacterized isoforms of divalent metal transporter (DMT)-1: implications for regulation and cellular function." Hubert N., Hentze M.W. Proc. Natl. Acad. Sci. U.S.A. 99:12345-12350(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-80 (ISOFORMS 3/4), ALTERNATIVE SPLICING. Strain: C57BL/6. Tissue: Duodenum. |
| [7] | "Cellular and subcellular localization of the Nramp2 iron transporter in the intestinal brush border and regulation by dietary iron." Canonne-Hergaux F., Gruenheid S., Ponka P., Gros P. Blood 93:4406-4417(1999) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, INDUCTION. |
| [8] | "Characterization of the iron transporter DMT1 (NRAMP2/DCT1) in red blood cells of normal and anemic mk/mk mice." Canonne-Hergaux F., Zhang A.-S., Ponka P., Gros P. Blood 98:3823-3830(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [9] | "Slc11a2 is required for intestinal iron absorption and erythropoiesis but dispensable in placenta and liver." Gunshin H., Fujiwara Y., Custodio A.O., Direnzo C., Robine S., Andrews N.C. J. Clin. Invest. 115:1258-1266(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [10] | "Ca2+ channel blockers reverse iron overload by a new mechanism via divalent metal transporter-1." Ludwiczek S., Theurl I., Muckenthaler M.U., Jakab M., Mair S.M., Theurl M., Kiss J., Paulmichl M., Hentze M.W., Ritter M., Weiss G. Nat. Med. 13:448-454(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NIFEDIPINE TREATMENT. |
| [11] | "Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2." Foot N.J., Dalton H.E., Shearwin-Whyatt L.M., Dorstyn L., Tan S.S., Yang B., Kumar S. Blood 112:4268-4275(2008) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION. |
| [12] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21; SER-564 AND SER-567, MASS SPECTROMETRY. Tissue: Macrophage. |
| [13] | "Microcytic anaemia mice have a mutation in Nramp2, a candidate iron transporter gene." Fleming M.D., Trenor C.C. III, Su M.A., Foernzler D., Beier D.R., Dietrich W.F., Andrews N.C. Nat. Genet. 16:383-386(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT MK ARG-185. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L33415 mRNA. Translation: AAC42051.1. AF029758 mRNA. Translation: AAC24496.1. AK049856 mRNA. Translation: BAC33960.1. AK083478 mRNA. Translation: BAC38930.1. AK148276 mRNA. Translation: BAE28454.1. CH466550 Genomic DNA. Translation: EDL04090.1. BC019137 mRNA. Translation: AAH19137.1. AJ493663 mRNA. Translation: CAD38518.1. Frameshift. |
| IPI | IPI00315758. IPI00379015. IPI00461614. IPI00944806. |
| PIR | A56852. |
| RefSeq | NP_001139633.1. NM_001146161.1. NP_032758.2. NM_008732.2. |
| UniGene | Mm.234608. |
3D structure databases | |
| ProteinModelPortal | P49282. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P49282. |
Proteomic databases | |
| PaxDb | P49282. |
| PRIDE | P49282. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000023774; ENSMUSP00000023774; ENSMUSG00000023030. ENSMUST00000138843; ENSMUSP00000116463; ENSMUSG00000023030. |
| GeneID | 18174. |
| KEGG | mmu:18174. |
| UCSC | uc007xrc.2. mouse. uc007xrd.2. mouse. |
Organism-specific databases | |
| CTD | 4891. |
| MGI | MGI:1345279. Slc11a2. |
Phylogenomic databases | |
| eggNOG | COG1914. |
| GeneTree | ENSGT00390000006526. |
| HOVERGEN | HBG052665. |
| InParanoid | Q8BWV3. |
| KO | K12347. |
| OMA | VIPVIIC. |
| OrthoDB | EOG4RFKSH. |
Gene expression databases | |
| ArrayExpress | P49282. |
| Bgee | P49282. |
| Genevestigator | P49282. |
| GermOnline | ENSMUSG00000023030. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001046. Nat-R-assoc-macro_Nramp. [Graphical view] |
| PANTHER | PTHR11706. PTHR11706. 1 hit. |
| Pfam | PF01566. Nramp. 1 hit. [Graphical view] |
| PRINTS | PR00447. NATRESASSCMP. |
| TIGRFAMs | TIGR01197. nramp. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SLC11A2. mouse. |
| NextBio | 293478. |
| SOURCE | Search... |
Entry information
| Entry name | NRAM2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P49282 Secondary accession number(s): O54903 Q8VCU6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
