Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P49282

- NRAM2_MOUSE

UniProt

P49282 - NRAM2_MOUSE

Protein

Natural resistance-associated macrophage protein 2

Gene

Slc11a2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 2 (22 Sep 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Important in metal transport, in particular iron. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution.2 Publications

    GO - Molecular functioni

    1. cadmium ion binding Source: Ensembl
    2. cadmium ion transmembrane transporter activity Source: Ensembl
    3. cobalt ion binding Source: Ensembl
    4. cobalt ion transmembrane transporter activity Source: MGI
    5. copper ion binding Source: Ensembl
    6. copper ion transmembrane transporter activity Source: Ensembl
    7. ferrous iron transmembrane transporter activity Source: MGI
    8. hydrogen ion transmembrane transporter activity Source: MGI
    9. iron ion binding Source: Ensembl
    10. iron ion transmembrane transporter activity Source: MGI
    11. lead ion transmembrane transporter activity Source: Ensembl
    12. manganese ion binding Source: Ensembl
    13. manganese ion transmembrane transporter activity Source: Ensembl
    14. nickel cation binding Source: Ensembl
    15. nickel cation transmembrane transporter activity Source: Ensembl
    16. solute:proton symporter activity Source: Ensembl
    17. vanadium ion transmembrane transporter activity Source: Ensembl
    18. zinc ion binding Source: Ensembl
    19. zinc ion transmembrane transporter activity Source: Ensembl

    GO - Biological processi

    1. activation of cysteine-type endopeptidase activity involved in apoptotic process Source: Ensembl
    2. cellular response to hypoxia Source: Ensembl
    3. cellular response to iron ion Source: Ensembl
    4. cellular response to oxidative stress Source: Ensembl
    5. cellular response to tumor necrosis factor Source: Ensembl
    6. cobalt ion transport Source: MGI
    7. dendrite morphogenesis Source: MGI
    8. detection of oxygen Source: Ensembl
    9. erythrocyte development Source: MGI
    10. ferrous iron import Source: MGI
    11. ferrous iron transport Source: MGI
    12. heme biosynthetic process Source: MGI
    13. hydrogen ion transmembrane transport Source: GOC
    14. iron ion transport Source: MGI
    15. learning or memory Source: MGI
    16. multicellular organismal iron ion homeostasis Source: MGI
    17. porphyrin-containing compound biosynthetic process Source: MGI
    18. porphyrin-containing compound metabolic process Source: MGI
    19. proton transport Source: MGI
    20. response to cadmium ion Source: Ensembl
    21. response to lead ion Source: Ensembl
    22. response to manganese ion Source: Ensembl

    Keywords - Biological processi

    Ion transport, Iron transport, Transport

    Keywords - Ligandi

    Iron

    Enzyme and pathway databases

    ReactomeiREACT_205755. Iron uptake and transport.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Natural resistance-associated macrophage protein 2
    Short name:
    NRAMP 2
    Alternative name(s):
    Divalent cation transporter 1
    Divalent metal transporter 1
    Short name:
    DMT-1
    Solute carrier family 11 member 2
    Gene namesi
    Name:Slc11a2
    Synonyms:Dct1, Dmt1, Nramp2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 15

    Organism-specific databases

    MGIiMGI:1345279. Slc11a2.

    Subcellular locationi

    Endosome membrane By similarity; Multi-pass membrane protein By similarity

    GO - Cellular componenti

    1. apical plasma membrane Source: Ensembl
    2. basal part of cell Source: Ensembl
    3. brush border Source: MGI
    4. cell surface Source: MGI
    5. cytoplasmic vesicle Source: Ensembl
    6. early endosome Source: MGI
    7. endomembrane system Source: MGI
    8. endosome Source: MGI
    9. integral component of plasma membrane Source: MGI
    10. late endosome membrane Source: Ensembl
    11. lysosomal membrane Source: Ensembl
    12. nucleus Source: Ensembl
    13. paraferritin complex Source: Ensembl
    14. perinuclear region of cytoplasm Source: Ensembl
    15. plasma membrane Source: MGI
    16. recycling endosome Source: MGI
    17. trans-Golgi network Source: Ensembl

    Keywords - Cellular componenti

    Endosome, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Defects in Slc11a2 are the cause of microcytic anemia (mk). Homozygous mk/mk mice have hypochromic microcytic anemia due to severe defects in intestinal iron absorption and erythroid iron utilization.

    Disruption phenotypei

    Mice display no apparent anatomical abnormalities. They are however anemic, show progressive postnatal growth retardation, and at birth have elevated liver iron stores compared with wild-type littermates. None survive for more than 7 days. Heterozygotes appear normal, showing no significant hematological abnormalities. However, by 8 weeks, their liver iron content is lower than in wild-type littermates.1 Publication

    Keywords - Diseasei

    Disease mutation

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 568568Natural resistance-associated macrophage protein 2PRO_0000212595Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi336 – 3361N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi349 – 3491N-linked (GlcNAc...)Sequence Analysis
    Modified residuei564 – 5641Phosphoserine1 Publication
    Modified residuei567 – 5671Phosphoserine1 Publication

    Post-translational modificationi

    Ubiquitinated by WWP2.1 Publication

    Keywords - PTMi

    Glycoprotein, Phosphoprotein, Ubl conjugation

    Proteomic databases

    PaxDbiP49282.
    PRIDEiP49282.

    PTM databases

    PhosphoSiteiP49282.

    Expressioni

    Tissue specificityi

    Isoform 2 is abundantly expressed in erythroid precursor cells (at protein level). Expressed at low levels in most tissues analyzed. Expressed at low levels in small intestine and at higher levels in kidney.2 Publications

    Inductioni

    Isoform 1 is up-regulated under iron-depletion conditions in the proximal portion of the duodenum where it is abundantly expressed in the brush border of absorptive epithelial cells (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiP49282.
    BgeeiP49282.
    GenevestigatoriP49282.

    Interactioni

    Subunit structurei

    Forms a complex with NDFIP1 and NEDD4L, in cortical neurons, in response to iron and colbalt exposure; this interaction leads to ubiquitination by NEDD4L and proteasome-dependent degradation. Interacts with NDFIP2 By similarity.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliP49282.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 6969CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini91 – 955ExtracellularSequence Analysis
    Topological domaini118 – 15437CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini176 – 1794ExtracellularSequence Analysis
    Topological domaini195 – 20814CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini230 – 25526ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini277 – 30125CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini323 – 36038ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini382 – 40827CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini430 – 44011ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini462 – 48221CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini504 – 5063ExtracellularSequence Analysis
    Topological domaini528 – 56841CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei70 – 9021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei96 – 11722HelicalSequence AnalysisAdd
    BLAST
    Transmembranei155 – 17521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei180 – 19415HelicalSequence AnalysisAdd
    BLAST
    Transmembranei209 – 22921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei256 – 27621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei302 – 32221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei361 – 38121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei409 – 42921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei441 – 46121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei483 – 50321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei507 – 52721HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the NRAMP family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1914.
    GeneTreeiENSGT00390000006526.
    HOVERGENiHBG052665.
    InParanoidiQ8BWV3.
    KOiK12347.
    OMAiGCHTPQI.
    OrthoDBiEOG77127K.
    PhylomeDBiP49282.
    TreeFamiTF315185.

    Family and domain databases

    HAMAPiMF_00221. NRAMP.
    InterProiIPR001046. NRAMP_fam.
    [Graphical view]
    PANTHERiPTHR11706. PTHR11706. 1 hit.
    PfamiPF01566. Nramp. 1 hit.
    [Graphical view]
    PRINTSiPR00447. NATRESASSCMP.
    TIGRFAMsiTIGR01197. nramp. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: P49282-1) [UniParc]FASTAAdd to Basket

    Also known as: Non-IRE

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVLDPKEKMP DDGASGDHGD SASLGAINPA YSNSSLPHST GDSEEPFTTY    50
    FDEKIPIPEE EYSCFSFRKL WAFTGPGFLM SIAYLDPGNI ESDLQSGAVA 100
    GFKLLWVLLL ATIVGLLLQR LAARLGVVTG LHLAEVCHRQ YPKVPRIILW 150
    LMVELAIIGS DMQEVIGSAI AINLLSAGRV PLWGGVLITI ADTFVFLFLD 200
    KYGLRKLEAF FGFLITIMAL TFGYEYITVK PSQSQVLRGM FVPSCPGCRT 250
    PQVEQAVGIV GAVIMPHNMY LHSALVKSRQ VNRANKQEVR EANKYFFIES 300
    CIALFVSFII NVFVVSVFAE AFFEKTNKQV VEVCKNNSSP HADLFPSDNS 350
    TLAVDIYKGG VVLGCYFGPA ALYIWAVGIL AAGQSSTMTG TYSGQFVMEG 400
    FLNLKWSRFA RVILTRSIAI IPTLLVAVFQ DVEHLTGMND FLNVLQSLQL 450
    PFALIPILTF TSLRPVMSEF SNGIGWRIAG GILVLIVCSI NMYFVVVYVQ 500
    ELGHVALYVV AAVVSVAYLT FVFYLGWQCL IALGLSFLDC GRSYRLGLTA 550
    QPELYLLNTV DADSVVSR 568
    Length:568
    Mass (Da):62,368
    Last modified:September 22, 2009 - v2
    Checksum:i603AAF697AAD3C74
    GO
    Isoform 1 (identifier: P49282-2) [UniParc]FASTAAdd to Basket

    Also known as: IRE

    The sequence of this isoform differs from the canonical sequence as follows:
         544-568: YRLGLTAQPELYLLNTVDADSVVSR → VSISKVLLSEDTSGGNIK

    Show »
    Length:561
    Mass (Da):61,421
    Checksum:iD2FAA52B8F73FFBC
    GO
    Isoform 3 (identifier: P49282-3) [UniParc]FASTAAdd to Basket

    Also known as: 1A-IRE

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGKKQPRAAAAAPNCELKSYSKSTDPQVSTM
         544-568: YRLGLTAQPELYLLNTVDADSVVSR → VSISKVLLSEDTSGGNIK

    Note: No experimental confirmation available.

    Show »
    Length:591
    Mass (Da):64,568
    Checksum:iF8119C955315B2F6
    GO
    Isoform 4 (identifier: P49282-4) [UniParc]FASTAAdd to Basket

    Also known as: 1A-Non-IRE

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MGKKQPRAAAAAPNCELKSYSKSTDPQVSTM

    Note: No experimental confirmation available.

    Show »
    Length:598
    Mass (Da):65,515
    Checksum:iED4B62ED656BAEBE
    GO

    Sequence cautioni

    The sequence CAD38518.1 differs from that shown. Reason: Frameshift at position 69.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti6 – 61K → E in BAE28454. (PubMed:16141072)Curated
    Sequence conflicti6 – 61K → E in CAD38518. (PubMed:12209011)Curated
    Sequence conflicti68 – 681R → S in AAC24496. 1 PublicationCurated
    Sequence conflicti69 – 702Missing in CAD38518. (PubMed:12209011)Curated
    Sequence conflicti142 – 1421P → R in BAC38930. (PubMed:16141072)Curated
    Sequence conflicti182 – 1821L → V in AAC42051. (PubMed:7789986)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti185 – 1851G → R in microcytic anemia. 1 Publication

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MGKKQPRAAAAAPNCELKSY SKSTDPQVSTM in isoform 3 and isoform 4. CuratedVSP_038145
    Alternative sequencei544 – 56825YRLGL…SVVSR → VSISKVLLSEDTSGGNIK in isoform 1 and isoform 3. 2 PublicationsVSP_003596Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L33415 mRNA. Translation: AAC42051.1.
    AF029758 mRNA. Translation: AAC24496.1.
    AK049856 mRNA. Translation: BAC33960.1.
    AK083478 mRNA. Translation: BAC38930.1.
    AK148276 mRNA. Translation: BAE28454.1.
    CH466550 Genomic DNA. Translation: EDL04090.1.
    BC019137 mRNA. Translation: AAH19137.1.
    AJ493663 mRNA. Translation: CAD38518.1. Frameshift.
    CCDSiCCDS37211.1. [P49282-1]
    CCDS49733.1. [P49282-2]
    PIRiA56852.
    RefSeqiNP_001139633.1. NM_001146161.1. [P49282-2]
    NP_032758.2. NM_008732.2. [P49282-1]
    XP_006520639.1. XM_006520576.1. [P49282-3]
    XP_006520640.1. XM_006520577.1. [P49282-1]
    XP_006520641.1. XM_006520578.1. [P49282-1]
    UniGeneiMm.234608.

    Genome annotation databases

    EnsembliENSMUST00000023774; ENSMUSP00000023774; ENSMUSG00000023030. [P49282-1]
    ENSMUST00000138843; ENSMUSP00000116463; ENSMUSG00000023030. [P49282-2]
    GeneIDi18174.
    KEGGimmu:18174.
    UCSCiuc007xrc.2. mouse. [P49282-1]
    uc007xrd.2. mouse. [P49282-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L33415 mRNA. Translation: AAC42051.1 .
    AF029758 mRNA. Translation: AAC24496.1 .
    AK049856 mRNA. Translation: BAC33960.1 .
    AK083478 mRNA. Translation: BAC38930.1 .
    AK148276 mRNA. Translation: BAE28454.1 .
    CH466550 Genomic DNA. Translation: EDL04090.1 .
    BC019137 mRNA. Translation: AAH19137.1 .
    AJ493663 mRNA. Translation: CAD38518.1 . Frameshift.
    CCDSi CCDS37211.1. [P49282-1 ]
    CCDS49733.1. [P49282-2 ]
    PIRi A56852.
    RefSeqi NP_001139633.1. NM_001146161.1. [P49282-2 ]
    NP_032758.2. NM_008732.2. [P49282-1 ]
    XP_006520639.1. XM_006520576.1. [P49282-3 ]
    XP_006520640.1. XM_006520577.1. [P49282-1 ]
    XP_006520641.1. XM_006520578.1. [P49282-1 ]
    UniGenei Mm.234608.

    3D structure databases

    ProteinModelPortali P49282.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei P49282.

    Proteomic databases

    PaxDbi P49282.
    PRIDEi P49282.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000023774 ; ENSMUSP00000023774 ; ENSMUSG00000023030 . [P49282-1 ]
    ENSMUST00000138843 ; ENSMUSP00000116463 ; ENSMUSG00000023030 . [P49282-2 ]
    GeneIDi 18174.
    KEGGi mmu:18174.
    UCSCi uc007xrc.2. mouse. [P49282-1 ]
    uc007xrd.2. mouse. [P49282-2 ]

    Organism-specific databases

    CTDi 4891.
    MGIi MGI:1345279. Slc11a2.

    Phylogenomic databases

    eggNOGi COG1914.
    GeneTreei ENSGT00390000006526.
    HOVERGENi HBG052665.
    InParanoidi Q8BWV3.
    KOi K12347.
    OMAi GCHTPQI.
    OrthoDBi EOG77127K.
    PhylomeDBi P49282.
    TreeFami TF315185.

    Enzyme and pathway databases

    Reactomei REACT_205755. Iron uptake and transport.

    Miscellaneous databases

    ChiTaRSi SLC11A2. mouse.
    NextBioi 293478.
    PROi P49282.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P49282.
    Bgeei P49282.
    Genevestigatori P49282.

    Family and domain databases

    HAMAPi MF_00221. NRAMP.
    InterProi IPR001046. NRAMP_fam.
    [Graphical view ]
    PANTHERi PTHR11706. PTHR11706. 1 hit.
    Pfami PF01566. Nramp. 1 hit.
    [Graphical view ]
    PRINTSi PR00447. NATRESASSCMP.
    TIGRFAMsi TIGR01197. nramp. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of a second mouse Nramp gene."
      Gruenheid S., Cellier M., Vidal S., Gros P.
      Genomics 25:514-525(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    2. "Nramp2 is mutated in the anemic Belgrade (b) rat: evidence of a role for Nramp2 in endosomal iron transport."
      Fleming M.D., Romano M.A., Su M.A., Garrick L.M., Garrick M.D., Andrews N.C.
      Proc. Natl. Acad. Sci. U.S.A. 95:1148-1153(1998)
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: DBA.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Embryo and Hippocampus.
    4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
      Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: FVB/N.
      Tissue: Kidney.
    6. "Previously uncharacterized isoforms of divalent metal transporter (DMT)-1: implications for regulation and cellular function."
      Hubert N., Hentze M.W.
      Proc. Natl. Acad. Sci. U.S.A. 99:12345-12350(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-80 (ISOFORMS 3/4), ALTERNATIVE SPLICING.
      Strain: C57BL/6.
      Tissue: Duodenum.
    7. "Cellular and subcellular localization of the Nramp2 iron transporter in the intestinal brush border and regulation by dietary iron."
      Canonne-Hergaux F., Gruenheid S., Ponka P., Gros P.
      Blood 93:4406-4417(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, INDUCTION.
    8. "Characterization of the iron transporter DMT1 (NRAMP2/DCT1) in red blood cells of normal and anemic mk/mk mice."
      Canonne-Hergaux F., Zhang A.-S., Ponka P., Gros P.
      Blood 98:3823-3830(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    9. "Slc11a2 is required for intestinal iron absorption and erythropoiesis but dispensable in placenta and liver."
      Gunshin H., Fujiwara Y., Custodio A.O., Direnzo C., Robine S., Andrews N.C.
      J. Clin. Invest. 115:1258-1266(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE.
    10. "Ca2+ channel blockers reverse iron overload by a new mechanism via divalent metal transporter-1."
      Ludwiczek S., Theurl I., Muckenthaler M.U., Jakab M., Mair S.M., Theurl M., Kiss J., Paulmichl M., Hentze M.W., Ritter M., Weiss G.
      Nat. Med. 13:448-454(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NIFEDIPINE TREATMENT.
    11. "Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2."
      Foot N.J., Dalton H.E., Shearwin-Whyatt L.M., Dorstyn L., Tan S.S., Yang B., Kumar S.
      Blood 112:4268-4275(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: UBIQUITINATION.
    12. "The phagosomal proteome in interferon-gamma-activated macrophages."
      Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
      Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-564 AND SER-567, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "Microcytic anaemia mice have a mutation in Nramp2, a candidate iron transporter gene."
      Fleming M.D., Trenor C.C. III, Su M.A., Foernzler D., Beier D.R., Dietrich W.F., Andrews N.C.
      Nat. Genet. 16:383-386(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT MK ARG-185.

    Entry informationi

    Entry nameiNRAM2_MOUSE
    AccessioniPrimary (citable) accession number: P49282
    Secondary accession number(s): O54903
    , Q3UFV5, Q8BJL2, Q8BWV3, Q8CFA0, Q8VCU6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1996
    Last sequence update: September 22, 2009
    Last modified: October 1, 2014
    This is version 119 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Miscellaneous

    Nifedipine induces duodenal iron accumulation and mobilizes iron from the liver of iron-overloaded mice.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3