Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Natural resistance-associated macrophage protein 2

Gene

Slc11a2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May serve to import iron into the mitochondria (By similarity). Important in metal transport, in particular iron. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution.By similarity2 Publications

GO - Molecular functioni

  1. cadmium ion binding Source: Ensembl
  2. cadmium ion transmembrane transporter activity Source: MGI
  3. cobalt ion binding Source: Ensembl
  4. cobalt ion transmembrane transporter activity Source: MGI
  5. copper ion binding Source: Ensembl
  6. copper ion transmembrane transporter activity Source: MGI
  7. ferrous iron transmembrane transporter activity Source: MGI
  8. hydrogen ion transmembrane transporter activity Source: MGI
  9. inorganic cation transmembrane transporter activity Source: MGI
  10. iron ion binding Source: Ensembl
  11. iron ion transmembrane transporter activity Source: MGI
  12. lead ion transmembrane transporter activity Source: MGI
  13. manganese ion binding Source: Ensembl
  14. manganese ion transmembrane transporter activity Source: MGI
  15. nickel cation binding Source: Ensembl
  16. nickel cation transmembrane transporter activity Source: MGI
  17. solute:proton symporter activity Source: MGI
  18. vanadium ion transmembrane transporter activity Source: MGI
  19. zinc ion binding Source: Ensembl
  20. zinc ion transmembrane transporter activity Source: Ensembl

GO - Biological processi

  1. activation of cysteine-type endopeptidase activity involved in apoptotic process Source: MGI
  2. cadmium ion transmembrane transport Source: MGI
  3. cation transmembrane transport Source: MGI
  4. cellular copper ion homeostasis Source: Ensembl
  5. cellular response to hypoxia Source: Ensembl
  6. cellular response to iron ion Source: Ensembl
  7. cellular response to oxidative stress Source: MGI
  8. cellular response to tumor necrosis factor Source: Ensembl
  9. cobalt ion transport Source: MGI
  10. copper ion import into cell Source: Ensembl
  11. copper ion transmembrane transport Source: MGI
  12. copper ion transport Source: MGI
  13. dendrite morphogenesis Source: MGI
  14. detection of oxygen Source: Ensembl
  15. erythrocyte development Source: MGI
  16. ferrous iron import Source: MGI
  17. ferrous iron transport Source: MGI
  18. heme biosynthetic process Source: MGI
  19. hydrogen ion transmembrane transport Source: GOC
  20. iron ion transmembrane transport Source: GOC
  21. iron ion transport Source: MGI
  22. lead ion transport Source: MGI
  23. learning or memory Source: MGI
  24. manganese ion transmembrane transport Source: MGI
  25. manganese ion transport Source: MGI
  26. multicellular organismal iron ion homeostasis Source: MGI
  27. nickel cation transmembrane transport Source: MGI
  28. nickel cation transport Source: MGI
  29. porphyrin-containing compound biosynthetic process Source: MGI
  30. porphyrin-containing compound metabolic process Source: MGI
  31. proton transport Source: MGI
  32. response to cadmium ion Source: Ensembl
  33. response to lead ion Source: Ensembl
  34. response to manganese ion Source: Ensembl
  35. vanadium ion transport Source: MGI
  36. zinc ion transmembrane transport Source: MGI
Complete GO annotation...

Keywords - Biological processi

Ion transport, Iron transport, Transport

Keywords - Ligandi

Iron

Enzyme and pathway databases

ReactomeiREACT_205755. Iron uptake and transport.
REACT_251299. Metal ion SLC transporters.

Names & Taxonomyi

Protein namesi
Recommended name:
Natural resistance-associated macrophage protein 2
Short name:
NRAMP 2
Alternative name(s):
Divalent cation transporter 1
Divalent metal transporter 1
Short name:
DMT-1
Solute carrier family 11 member 2
Gene namesi
Name:Slc11a2
Synonyms:Dct1, Dmt1, Nramp2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 15

Organism-specific databases

MGIiMGI:1345279. Slc11a2.

Subcellular locationi

Endosome membrane By similarity; Multi-pass membrane protein By similarity. Mitochondrion outer membrane By similarity; Multi-pass membrane protein

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 6969CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei70 – 9021HelicalSequence AnalysisAdd
BLAST
Topological domaini91 – 955ExtracellularSequence Analysis
Transmembranei96 – 11722HelicalSequence AnalysisAdd
BLAST
Topological domaini118 – 15437CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei155 – 17521HelicalSequence AnalysisAdd
BLAST
Topological domaini176 – 1794ExtracellularSequence Analysis
Transmembranei180 – 19415HelicalSequence AnalysisAdd
BLAST
Topological domaini195 – 20814CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei209 – 22921HelicalSequence AnalysisAdd
BLAST
Topological domaini230 – 25526ExtracellularSequence AnalysisAdd
BLAST
Transmembranei256 – 27621HelicalSequence AnalysisAdd
BLAST
Topological domaini277 – 30125CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei302 – 32221HelicalSequence AnalysisAdd
BLAST
Topological domaini323 – 36038ExtracellularSequence AnalysisAdd
BLAST
Transmembranei361 – 38121HelicalSequence AnalysisAdd
BLAST
Topological domaini382 – 40827CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei409 – 42921HelicalSequence AnalysisAdd
BLAST
Topological domaini430 – 44011ExtracellularSequence AnalysisAdd
BLAST
Transmembranei441 – 46121HelicalSequence AnalysisAdd
BLAST
Topological domaini462 – 48221CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei483 – 50321HelicalSequence AnalysisAdd
BLAST
Topological domaini504 – 5063ExtracellularSequence Analysis
Transmembranei507 – 52721HelicalSequence AnalysisAdd
BLAST
Topological domaini528 – 56841CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. apical part of cell Source: MGI
  2. apical plasma membrane Source: MGI
  3. basal part of cell Source: MGI
  4. brush border Source: MGI
  5. cell surface Source: MGI
  6. cytoplasm Source: MGI
  7. cytoplasmic vesicle Source: MGI
  8. early endosome Source: MGI
  9. endomembrane system Source: MGI
  10. endosome Source: MGI
  11. integral component of plasma membrane Source: MGI
  12. late endosome Source: MGI
  13. late endosome membrane Source: MGI
  14. lysosomal membrane Source: MGI
  15. lysosome Source: MGI
  16. membrane Source: MGI
  17. mitochondrial outer membrane Source: UniProtKB-SubCell
  18. nucleus Source: MGI
  19. paraferritin complex Source: MGI
  20. perinuclear region of cytoplasm Source: MGI
  21. plasma membrane Source: MGI
  22. recycling endosome Source: MGI
  23. trans-Golgi network Source: MGI
  24. vacuole Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Endosome, Membrane, Mitochondrion, Mitochondrion outer membrane

Pathology & Biotechi

Involvement in diseasei

Defects in Slc11a2 are the cause of microcytic anemia (mk). Homozygous mk/mk mice have hypochromic microcytic anemia due to severe defects in intestinal iron absorption and erythroid iron utilization.

Disruption phenotypei

Mice display no apparent anatomical abnormalities. They are however anemic, show progressive postnatal growth retardation, and at birth have elevated liver iron stores compared with wild-type littermates. None survive for more than 7 days. Heterozygotes appear normal, showing no significant hematological abnormalities. However, by 8 weeks, their liver iron content is lower than in wild-type littermates.1 Publication

Keywords - Diseasei

Disease mutation

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 568568Natural resistance-associated macrophage protein 2PRO_0000212595Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi336 – 3361N-linked (GlcNAc...)Sequence Analysis
Glycosylationi349 – 3491N-linked (GlcNAc...)Sequence Analysis
Modified residuei564 – 5641Phosphoserine1 Publication
Modified residuei567 – 5671Phosphoserine1 Publication

Post-translational modificationi

Ubiquitinated by WWP2.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP49282.
PaxDbiP49282.
PRIDEiP49282.

PTM databases

PhosphoSiteiP49282.

Expressioni

Tissue specificityi

Isoform 2 is abundantly expressed in erythroid precursor cells (at protein level). Expressed at low levels in most tissues analyzed. Expressed at low levels in small intestine and at higher levels in kidney.2 Publications

Inductioni

Isoform 1 is up-regulated under iron-depletion conditions in the proximal portion of the duodenum where it is abundantly expressed in the brush border of absorptive epithelial cells (at protein level).1 Publication

Gene expression databases

BgeeiP49282.
ExpressionAtlasiP49282. baseline and differential.
GenevestigatoriP49282.

Interactioni

Subunit structurei

Forms a complex with NDFIP1 and NEDD4L, in cortical neurons, in response to iron and colbalt exposure; this interaction leads to ubiquitination by NEDD4L and proteasome-dependent degradation. Interacts with NDFIP2. Interacts with COX2 and TOM6 at the outer mitochondrion membrane (By similarity).By similarity

Structurei

3D structure databases

ProteinModelPortaliP49282.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the NRAMP family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1914.
GeneTreeiENSGT00390000006526.
HOVERGENiHBG052665.
InParanoidiP49282.
KOiK12347.
OMAiCYFGPAT.
OrthoDBiEOG77127K.
PhylomeDBiP49282.
TreeFamiTF315185.

Family and domain databases

HAMAPiMF_00221. NRAMP.
InterProiIPR001046. NRAMP_fam.
[Graphical view]
PANTHERiPTHR11706. PTHR11706. 1 hit.
PfamiPF01566. Nramp. 1 hit.
[Graphical view]
PRINTSiPR00447. NATRESASSCMP.
TIGRFAMsiTIGR01197. nramp. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: P49282-1) [UniParc]FASTAAdd to basket

Also known as: Non-IRE

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVLDPKEKMP DDGASGDHGD SASLGAINPA YSNSSLPHST GDSEEPFTTY
60 70 80 90 100
FDEKIPIPEE EYSCFSFRKL WAFTGPGFLM SIAYLDPGNI ESDLQSGAVA
110 120 130 140 150
GFKLLWVLLL ATIVGLLLQR LAARLGVVTG LHLAEVCHRQ YPKVPRIILW
160 170 180 190 200
LMVELAIIGS DMQEVIGSAI AINLLSAGRV PLWGGVLITI ADTFVFLFLD
210 220 230 240 250
KYGLRKLEAF FGFLITIMAL TFGYEYITVK PSQSQVLRGM FVPSCPGCRT
260 270 280 290 300
PQVEQAVGIV GAVIMPHNMY LHSALVKSRQ VNRANKQEVR EANKYFFIES
310 320 330 340 350
CIALFVSFII NVFVVSVFAE AFFEKTNKQV VEVCKNNSSP HADLFPSDNS
360 370 380 390 400
TLAVDIYKGG VVLGCYFGPA ALYIWAVGIL AAGQSSTMTG TYSGQFVMEG
410 420 430 440 450
FLNLKWSRFA RVILTRSIAI IPTLLVAVFQ DVEHLTGMND FLNVLQSLQL
460 470 480 490 500
PFALIPILTF TSLRPVMSEF SNGIGWRIAG GILVLIVCSI NMYFVVVYVQ
510 520 530 540 550
ELGHVALYVV AAVVSVAYLT FVFYLGWQCL IALGLSFLDC GRSYRLGLTA
560
QPELYLLNTV DADSVVSR
Length:568
Mass (Da):62,368
Last modified:September 22, 2009 - v2
Checksum:i603AAF697AAD3C74
GO
Isoform 1 (identifier: P49282-2) [UniParc]FASTAAdd to basket

Also known as: IRE

The sequence of this isoform differs from the canonical sequence as follows:
     544-568: YRLGLTAQPELYLLNTVDADSVVSR → VSISKVLLSEDTSGGNIK

Show »
Length:561
Mass (Da):61,421
Checksum:iD2FAA52B8F73FFBC
GO
Isoform 3 (identifier: P49282-3) [UniParc]FASTAAdd to basket

Also known as: 1A-IRE

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGKKQPRAAAAAPNCELKSYSKSTDPQVSTM
     544-568: YRLGLTAQPELYLLNTVDADSVVSR → VSISKVLLSEDTSGGNIK

Note: No experimental confirmation available.

Show »
Length:591
Mass (Da):64,568
Checksum:iF8119C955315B2F6
GO
Isoform 4 (identifier: P49282-4) [UniParc]FASTAAdd to basket

Also known as: 1A-Non-IRE

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGKKQPRAAAAAPNCELKSYSKSTDPQVSTM

Note: No experimental confirmation available.

Show »
Length:598
Mass (Da):65,515
Checksum:iED4B62ED656BAEBE
GO

Sequence cautioni

The sequence CAD38518.1 differs from that shown. Reason: Frameshift at position 69. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti6 – 61K → E in BAE28454 (PubMed:16141072).Curated
Sequence conflicti6 – 61K → E in CAD38518 (PubMed:12209011).Curated
Sequence conflicti68 – 681R → S in AAC24496 (Ref. 2) Curated
Sequence conflicti69 – 702Missing in CAD38518 (PubMed:12209011).Curated
Sequence conflicti142 – 1421P → R in BAC38930 (PubMed:16141072).Curated
Sequence conflicti182 – 1821L → V in AAC42051 (PubMed:7789986).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti185 – 1851G → R in microcytic anemia. 1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MGKKQPRAAAAAPNCELKSY SKSTDPQVSTM in isoform 3 and isoform 4. CuratedVSP_038145
Alternative sequencei544 – 56825YRLGL…SVVSR → VSISKVLLSEDTSGGNIK in isoform 1 and isoform 3. 2 PublicationsVSP_003596Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L33415 mRNA. Translation: AAC42051.1.
AF029758 mRNA. Translation: AAC24496.1.
AK049856 mRNA. Translation: BAC33960.1.
AK083478 mRNA. Translation: BAC38930.1.
AK148276 mRNA. Translation: BAE28454.1.
CH466550 Genomic DNA. Translation: EDL04090.1.
BC019137 mRNA. Translation: AAH19137.1.
AJ493663 mRNA. Translation: CAD38518.1. Frameshift.
CCDSiCCDS37211.1. [P49282-1]
CCDS49733.1. [P49282-2]
PIRiA56852.
RefSeqiNP_001139633.1. NM_001146161.1. [P49282-2]
NP_032758.2. NM_008732.2. [P49282-1]
XP_006520639.1. XM_006520576.1. [P49282-3]
XP_006520640.1. XM_006520577.1. [P49282-1]
XP_006520641.1. XM_006520578.1. [P49282-1]
UniGeneiMm.234608.

Genome annotation databases

EnsembliENSMUST00000023774; ENSMUSP00000023774; ENSMUSG00000023030. [P49282-1]
ENSMUST00000138843; ENSMUSP00000116463; ENSMUSG00000023030. [P49282-2]
GeneIDi18174.
KEGGimmu:18174.
UCSCiuc007xrc.2. mouse. [P49282-1]
uc007xrd.2. mouse. [P49282-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L33415 mRNA. Translation: AAC42051.1.
AF029758 mRNA. Translation: AAC24496.1.
AK049856 mRNA. Translation: BAC33960.1.
AK083478 mRNA. Translation: BAC38930.1.
AK148276 mRNA. Translation: BAE28454.1.
CH466550 Genomic DNA. Translation: EDL04090.1.
BC019137 mRNA. Translation: AAH19137.1.
AJ493663 mRNA. Translation: CAD38518.1. Frameshift.
CCDSiCCDS37211.1. [P49282-1]
CCDS49733.1. [P49282-2]
PIRiA56852.
RefSeqiNP_001139633.1. NM_001146161.1. [P49282-2]
NP_032758.2. NM_008732.2. [P49282-1]
XP_006520639.1. XM_006520576.1. [P49282-3]
XP_006520640.1. XM_006520577.1. [P49282-1]
XP_006520641.1. XM_006520578.1. [P49282-1]
UniGeneiMm.234608.

3D structure databases

ProteinModelPortaliP49282.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSiteiP49282.

Proteomic databases

MaxQBiP49282.
PaxDbiP49282.
PRIDEiP49282.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000023774; ENSMUSP00000023774; ENSMUSG00000023030. [P49282-1]
ENSMUST00000138843; ENSMUSP00000116463; ENSMUSG00000023030. [P49282-2]
GeneIDi18174.
KEGGimmu:18174.
UCSCiuc007xrc.2. mouse. [P49282-1]
uc007xrd.2. mouse. [P49282-2]

Organism-specific databases

CTDi4891.
MGIiMGI:1345279. Slc11a2.

Phylogenomic databases

eggNOGiCOG1914.
GeneTreeiENSGT00390000006526.
HOVERGENiHBG052665.
InParanoidiP49282.
KOiK12347.
OMAiCYFGPAT.
OrthoDBiEOG77127K.
PhylomeDBiP49282.
TreeFamiTF315185.

Enzyme and pathway databases

ReactomeiREACT_205755. Iron uptake and transport.
REACT_251299. Metal ion SLC transporters.

Miscellaneous databases

ChiTaRSiSlc11a2. mouse.
NextBioi293478.
PROiP49282.
SOURCEiSearch...

Gene expression databases

BgeeiP49282.
ExpressionAtlasiP49282. baseline and differential.
GenevestigatoriP49282.

Family and domain databases

HAMAPiMF_00221. NRAMP.
InterProiIPR001046. NRAMP_fam.
[Graphical view]
PANTHERiPTHR11706. PTHR11706. 1 hit.
PfamiPF01566. Nramp. 1 hit.
[Graphical view]
PRINTSiPR00447. NATRESASSCMP.
TIGRFAMsiTIGR01197. nramp. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of a second mouse Nramp gene."
    Gruenheid S., Cellier M., Vidal S., Gros P.
    Genomics 25:514-525(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "Nramp2 is mutated in the anemic Belgrade (b) rat: evidence of a role for Nramp2 in endosomal iron transport."
    Fleming M.D., Romano M.A., Su M.A., Garrick L.M., Garrick M.D., Andrews N.C.
    Proc. Natl. Acad. Sci. U.S.A. 95:1148-1153(1998)
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: DBA.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Embryo and Hippocampus.
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: FVB/N.
    Tissue: Kidney.
  6. "Previously uncharacterized isoforms of divalent metal transporter (DMT)-1: implications for regulation and cellular function."
    Hubert N., Hentze M.W.
    Proc. Natl. Acad. Sci. U.S.A. 99:12345-12350(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-80 (ISOFORMS 3/4), ALTERNATIVE SPLICING.
    Strain: C57BL/6.
    Tissue: Duodenum.
  7. "Cellular and subcellular localization of the Nramp2 iron transporter in the intestinal brush border and regulation by dietary iron."
    Canonne-Hergaux F., Gruenheid S., Ponka P., Gros P.
    Blood 93:4406-4417(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, INDUCTION.
  8. "Characterization of the iron transporter DMT1 (NRAMP2/DCT1) in red blood cells of normal and anemic mk/mk mice."
    Canonne-Hergaux F., Zhang A.-S., Ponka P., Gros P.
    Blood 98:3823-3830(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  9. "Slc11a2 is required for intestinal iron absorption and erythropoiesis but dispensable in placenta and liver."
    Gunshin H., Fujiwara Y., Custodio A.O., Direnzo C., Robine S., Andrews N.C.
    J. Clin. Invest. 115:1258-1266(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE.
  10. "Ca2+ channel blockers reverse iron overload by a new mechanism via divalent metal transporter-1."
    Ludwiczek S., Theurl I., Muckenthaler M.U., Jakab M., Mair S.M., Theurl M., Kiss J., Paulmichl M., Hentze M.W., Ritter M., Weiss G.
    Nat. Med. 13:448-454(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NIFEDIPINE TREATMENT.
  11. "Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2."
    Foot N.J., Dalton H.E., Shearwin-Whyatt L.M., Dorstyn L., Tan S.S., Yang B., Kumar S.
    Blood 112:4268-4275(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION.
  12. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-564 AND SER-567, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "Microcytic anaemia mice have a mutation in Nramp2, a candidate iron transporter gene."
    Fleming M.D., Trenor C.C. III, Su M.A., Foernzler D., Beier D.R., Dietrich W.F., Andrews N.C.
    Nat. Genet. 16:383-386(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT MK ARG-185.

Entry informationi

Entry nameiNRAM2_MOUSE
AccessioniPrimary (citable) accession number: P49282
Secondary accession number(s): O54903
, Q3UFV5, Q8BJL2, Q8BWV3, Q8CFA0, Q8VCU6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: September 22, 2009
Last modified: March 4, 2015
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

Nifedipine induces duodenal iron accumulation and mobilizes iron from the liver of iron-overloaded mice.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.