P49281 (NRAM2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 124.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Natural resistance-associated macrophage protein 2 Short name=NRAMP 2 Alternative name(s): Divalent cation transporter 1 Divalent metal transporter 1 Short name=DMT-1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 568 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Important in metal transport, in particular iron. Can also transport manganese, cobalt, cadmium, nickel, vanadium and lead. Involved in apical iron uptake into duodenal enterocytes. Involved in iron transport from acidified endosomes into the cytoplasm of erythroid precursor cells. May play an important role in hepatic iron accumulation and tissue iron distribution. Ref.12 |
| Subunit structure | Forms a complex with NDFIP1 and NEDD4L, in cortical neurons, in response to iron and colbalt exposure; this interaction leads to ubiquitination by NEDD4L and proteasome-dependent degradation. Interacts with NDFIP2. Ref.14 Ref.15 |
| Subcellular location | |
| Tissue specificity | Ubiquitously expressed. Isoform 1 is highly expressed in brain. Isoform 2 is highly expressed in spleen, thymus and pancreas. Isoform 3 and isoform 4 are abundantly expressed in duodenum and kidney. Ref.3 Ref.4 |
| Post-translational modification | Ubiquitinated by WWP2 By similarity. |
| Involvement in disease | Hypochromic microcytic anemia (HCMA) [MIM:206100]: Characterized by an abnormal hemoglobin content in the erythrocytes which are reduced in size. It may be hereditary or acquired. Mutations in SLC11A2 are associated with progressive liver iron overload and normal to moderately elevated serum ferritin levels. |
| Miscellaneous | NRAMP2-mediated iron uptake is markedly stimulated by nifedipine in a concentration-dependent manner. |
| Sequence similarities | Belongs to the NRAMP family. |
| Biophysicochemical properties | pH dependence: Optimum pH is 5.5-6.5 for Fe2+ uptake. Ref.13 |
| Sequence caution | The sequence AAH02592.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA34374.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: P49281-1) Also known as: Non-IRE; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P49281-2) Also known as: IRE; The sequence of this isoform differs from the canonical sequence as follows: 544-568: CHLGLTAQPELYLLNTMDADSLVSR → VSISKGLLTEEATRGYVK | ||||||
| Isoform 3 (identifier: P49281-3) Also known as: 1A-IRE; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MRKKQLKTEAAPHCELKSYSKNSATQVSTM 544-568: CHLGLTAQPELYLLNTMDADSLVSR → VSISKGLLTEEATRGYVK | ||||||
| Isoform 4 (identifier: P49281-4) Also known as: 1A-Non-IRE; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MRKKQLKTEAAPHCELKSYSKNSATQVSTM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: P49281-5) The sequence of this isoform differs from the canonical sequence as follows: 1-12: MVLGPEQKMSDD → MSTVDYLN 544-568: CHLGLTAQPELYLLNTMDADSLVSR → VSISKGLLTEEATRGYVK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 568 | 568 | Natural resistance-associated macrophage protein 2 | PRO_0000212594 | |||||
Regions | |||||||||
| Topological domain | 1 – 69 | 69 | Cytoplasmic Potential | ||||||
| Transmembrane | 70 – 90 | 21 | Helical; Potential | ||||||
| Topological domain | 91 – 96 | 6 | Extracellular Potential | ||||||
| Transmembrane | 97 – 117 | 21 | Helical; Potential | ||||||
| Topological domain | 118 – 154 | 37 | Cytoplasmic Potential | ||||||
| Transmembrane | 155 – 175 | 21 | Helical; Potential | ||||||
| Topological domain | 176 – 179 | 4 | Extracellular Potential | ||||||
| Transmembrane | 180 – 200 | 21 | Helical; Potential | ||||||
| Topological domain | 201 – 208 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 209 – 229 | 21 | Helical; Potential | ||||||
| Topological domain | 230 – 255 | 26 | Extracellular Potential | ||||||
| Transmembrane | 256 – 276 | 21 | Helical; Potential | ||||||
| Topological domain | 277 – 301 | 25 | Cytoplasmic Potential | ||||||
| Transmembrane | 302 – 322 | 21 | Helical; Potential | ||||||
| Topological domain | 323 – 360 | 38 | Extracellular Potential | ||||||
| Transmembrane | 361 – 381 | 21 | Helical; Potential | ||||||
| Topological domain | 382 – 408 | 27 | Cytoplasmic Potential | ||||||
| Transmembrane | 409 – 429 | 21 | Helical; Potential | ||||||
| Topological domain | 430 – 440 | 11 | Extracellular Potential | ||||||
| Transmembrane | 441 – 461 | 21 | Helical; Potential | ||||||
| Topological domain | 462 – 482 | 21 | Cytoplasmic Potential | ||||||
| Transmembrane | 483 – 503 | 21 | Helical; Potential | ||||||
| Topological domain | 504 – 506 | 3 | Extracellular Potential | ||||||
| Transmembrane | 507 – 527 | 21 | Helical; Potential | ||||||
| Topological domain | 528 – 568 | 41 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 21 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 564 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 567 | 1 | Phosphoserine By similarity | ||||||
| Glycosylation | 336 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 349 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 12 | 12 | MVLGP…KMSDD → MSTVDYLN in isoform 5. | VSP_046058 | |||||
| Alternative sequence | 1 | 1 | M → MRKKQLKTEAAPHCELKSYS KNSATQVSTM in isoform 3 and isoform 4. | VSP_038144 | |||||
| Alternative sequence | 544 – 568 | 25 | CHLGL…SLVSR → VSISKGLLTEEATRGYVK in isoform 1, isoform 3 and isoform 5. | VSP_003595 | |||||
| Natural variant | 48 | 1 | A → T in a colorectal cancer sample; somatic mutation. Ref.19 | VAR_036434 | |||||
| Natural variant | 114 | 1 | Missing in HCMA. Ref.18 | VAR_033011 | |||||
| Natural variant | 212 | 1 | G → V in HCMA. Ref.18 | VAR_033012 | |||||
| Natural variant | 399 | 1 | E → D in HCMA; increased skipping of exon 12. Ref.16 | VAR_033013 | |||||
| Natural variant | 416 | 1 | R → C in HCMA. Ref.17 | VAR_033014 | |||||
| Natural variant | 435 | 1 | L → I. Ref.3 | VAR_008882 | |||||
Experimental info | |||||||||
| Sequence conflict | 58 – 59 | 2 | PE → GM in AAA79219. Ref.11 | ||||||
| Sequence conflict | 81 | 1 | S → T in AAA79219. Ref.11 | ||||||
| Sequence conflict | 119 | 1 | Q → K in AAI00015. Ref.10 | ||||||
| Sequence conflict | 124 | 1 | R → K in AAA79219. Ref.11 | ||||||
| Sequence conflict | 462 – 463 | 2 | SL → YV in AAA79219. Ref.11 | ||||||
| Sequence conflict | 476 | 1 | W → C in AAA79219. Ref.11 | ||||||
| Isoform 5: | |||||||||
| Sequence conflict | 6 | 1 | Y → S in BAG59096. Ref.6 | ||||||
| Sequence conflict | 6 | 1 | Y → S in BAH14878. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete nucleotide sequence of human NRAMP2 cDNA." Kishi F., Tabuchi M. Mol. Immunol. 34:839-842(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Human natural resistance-associated macrophage protein 2: gene cloning and protein identification." Kishi F., Tabuchi M. Biochem. Biophys. Res. Commun. 251:775-783(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Placenta. |
| [3] | "The human Nramp2 gene: characterization of the gene structure, alternative splicing, promoter region and polymorphisms." Lee P.L., Gelbart T., West C., Halloran C., Beutler E. Blood Cells Mol. Dis. 24:199-215(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, VARIANT ILE-435. |
| [4] | "Previously uncharacterized isoforms of divalent metal transporter (DMT)-1: implications for regulation and cellular function." Hubert N., Hentze M.W. Proc. Natl. Acad. Sci. U.S.A. 99:12345-12350(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 1-583 (ISOFORM 3), ALTERNATIVE SPLICING (ISOFORMS 2 AND 4), TISSUE SPECIFICITY. |
| [5] | "Cloning and functional expression of the full length human NRAMP2 iron transporter." Worthington M.T., Battle E., Luo R.Q. Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5). Tissue: Brain, Thalamus and Trachea. |
| [7] | "Identification of immuno-peptidmics that are recognized by tumor-reactive CTL generated from TIL of colon cancer patients." Shichijo S., Itoh K. Submitted (MAY-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Colon adenocarcinoma. |
| [8] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Hypothalamus and Neuroblastoma. |
| [11] | "Cloning and characterization of a second human NRAMP gene on chromosome 12q13." Vidal S., Belouchi A.-M., Cellier M., Beatty B., Gros P. Mamm. Genome 6:224-230(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 58-568 (ISOFORM 1). Tissue: Liver. |
| [12] | "Functional properties of multiple isoforms of human divalent metal-ion transporter 1 (DMT1)." Mackenzie B., Takanaga H., Hubert N., Rolfs A., Hediger M.A. Biochem. J. 403:59-69(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "Ca2+ channel blockers reverse iron overload by a new mechanism via divalent metal transporter-1." Ludwiczek S., Theurl I., Muckenthaler M.U., Jakab M., Mair S.M., Theurl M., Kiss J., Paulmichl M., Hentze M.W., Ritter M., Weiss G. Nat. Med. 13:448-454(2007) [PubMed] [Europe PMC] [Abstract] Cited for: BIOPHYSICOCHEMICAL PROPERTIES, NIFEDIPINE TREATMENT. |
| [14] | "Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2." Foot N.J., Dalton H.E., Shearwin-Whyatt L.M., Dorstyn L., Tan S.S., Yang B., Kumar S. Blood 112:4268-4275(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NDFIP1; NDFIP2 AND WWP2, SUBCELLULAR LOCATION. |
| [15] | "Divalent metal transporter 1 (DMT1) regulation by Ndfip1 prevents metal toxicity in human neurons." Howitt J., Putz U., Lackovic J., Doan A., Dorstyn L., Cheng H., Yang B., Chan-Ling T., Silke J., Kumar S., Tan S.S. Proc. Natl. Acad. Sci. U.S.A. 106:15489-15494(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NDFIP1 AND NEDD4L. |
| [16] | "Identification of a human mutation of DMT1 in a patient with microcytic anemia and iron overload." Mims M.P., Guan Y., Pospisilova D., Priwitzerova M., Indrak K., Ponka P., Divoky V., Prchal J.T. Blood 105:1337-1342(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HCMA ASP-399. |
| [17] | "Microcytic anemia and hepatic iron overload in a child with compound heterozygous mutations in DMT1 (SCL11A2)." Iolascon A., d'Apolito M., Servedio V., Cimmino F., Piga A., Camaschella C. Blood 107:349-354(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT HCMA CYS-416. |
| [18] | "Two new human DMT1 gene mutations in a patient with microcytic anemia, low ferritinemia, and liver iron overload." Beaumont C., Delaunay J., Hetet G., Grandchamp B., de Montalembert M., Tchernia G. Blood 107:4168-4170(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HCMA VAL-114 DEL AND VAL-212. |
| [19] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] THR-48. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB004857 mRNA. Translation: BAA24933.1. AB015355 Genomic DNA. Translation: BAA34374.1. Sequence problems. AF064482 AF064481 Genomic DNA. Translation: AAC21460.1.AF064483 AF064482 Genomic DNA. Translation: AAC21461.1.AF064484 mRNA. Translation: AAC21459.1. AJ493662 mRNA. Translation: CAD38517.1. AF046997 mRNA. Translation: AAC18078.1. AK094735 mRNA. Translation: BAG52920.1. AK296445 mRNA. Translation: BAG59096.1. AK316507 mRNA. Translation: BAH14878.1. AB062284 mRNA. Translation: BAB93467.1. AC087884 Genomic DNA. No translation available. CH471111 Genomic DNA. Translation: EAW58159.1. BC002592 mRNA. Translation: AAH02592.1. Different initiation. BC100014 mRNA. Translation: AAI00015.1. L37347 mRNA. Translation: AAA79219.1. |
| IPI | IPI00394753. IPI00465037. IPI00793358. IPI00795148. IPI00944520. |
| PIR | I57022. |
| RefSeq | NP_000608.1. NM_000617.2. NP_001167596.1. NM_001174125.1. NP_001167597.1. NM_001174126.1. NP_001167598.1. NM_001174127.1. NP_001167599.1. NM_001174128.1. NP_001167600.1. NM_001174129.1. NP_001167601.1. NM_001174130.1. |
| UniGene | Hs.505545. |
3D structure databases | |
| ProteinModelPortal | P49281. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-48957N. |
| IntAct | P49281. 1 interaction. |
| STRING | 9606.ENSP00000262052. |
Protein family/group databases | |
| TCDB | 2.A.55.2.1. metal ion (Mn2+-iron) transporter (Nramp) family. |
PTM databases | |
| PhosphoSite | P49281. |
Polymorphism databases | |
| DMDM | 8247934. |
Proteomic databases | |
| PaxDb | P49281. |
| PRIDE | P49281. |
Protocols and materials databases | |
| DNASU | 4891. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000262051; ENSP00000262051; ENSG00000110911. ENST00000262052; ENSP00000262052; ENSG00000110911. ENST00000394904; ENSP00000378364; ENSG00000110911. ENST00000541174; ENSP00000444542; ENSG00000110911. ENST00000545993; ENSP00000442810; ENSG00000110911. ENST00000546636; ENSP00000449008; ENSG00000110911. ENST00000547198; ENSP00000446769; ENSG00000110911. ENST00000547688; ENSP00000449200; ENSG00000110911. |
| GeneID | 4891. |
| KEGG | hsa:4891. |
| UCSC | uc001rxc.4. human. uc001rxh.2. human. uc001rxk.2. human. |
Organism-specific databases | |
| CTD | 4891. |
| GeneCards | GC12M051375. |
| HGNC | HGNC:10908. SLC11A2. |
| HPA | HPA032139. HPA032140. |
| MIM | 206100. phenotype. 600523. gene. |
| neXtProt | NX_P49281. |
| Orphanet | 83642. Microcytic anemia with liver iron overload. |
| PharmGKB | PA259. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1914. |
| HOVERGEN | HBG052665. |
| KO | K12347. |
| OMA | ERYSATK. |
| OrthoDB | EOG4RFKSH. |
| PhylomeDB | P49281. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | P49281. |
| Bgee | P49281. |
| CleanEx | HS_SLC11A2. |
| Genevestigator | P49281. |
| GermOnline | ENSG00000110911. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001046. Nat-R-assoc-macro_Nramp. [Graphical view] |
| PANTHER | PTHR11706. PTHR11706. 1 hit. |
| Pfam | PF01566. Nramp. 1 hit. [Graphical view] |
| PRINTS | PR00447. NATRESASSCMP. |
| TIGRFAMs | TIGR01197. nramp. 1 hit. |
| ProtoNet | Search... |
Other | |
| BindingDB | P49281. |
| ChEMBL | CHEMBL1932895. |
| ChiTaRS | SLC11A2. human. |
| GenomeRNAi | 4891. |
| NextBio | 18825. |
| SOURCE | Search... |
Entry information
| Entry name | NRAM2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P49281 Secondary accession number(s): B3KT08 Q96J35 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
