Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P49238

- CX3C1_HUMAN

UniProt

P49238 - CX3C1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

CX3C chemokine receptor 1

Gene

CX3CR1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for the CX3C chemokine fractalkine and mediates both its adhesive and migratory functions. Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro). Isoform 2 and isoform 3 seem to be more potent HIV-1 coreceptors than isoform 1.

GO - Molecular functioni

  1. chemokine receptor activity Source: ProtInc
  2. C-X3-C chemokine receptor activity Source: Ensembl

GO - Biological processi

  1. cell adhesion Source: ProtInc
  2. cellular defense response Source: ProtInc
  3. cellular response to lipopolysaccharide Source: Ensembl
  4. cellular response to transforming growth factor beta stimulus Source: Ensembl
  5. cerebral cortex cell migration Source: Ensembl
  6. chemokine-mediated signaling pathway Source: GOC
  7. chemotaxis Source: ProtInc
  8. G-protein coupled receptor signaling pathway Source: ProtInc
  9. macrophage chemotaxis Source: Ensembl
  10. microglial cell activation involved in immune response Source: Ensembl
  11. negative regulation of angiogenesis Source: Ensembl
  12. negative regulation of cell migration Source: Ensembl
  13. negative regulation of extrinsic apoptotic signaling pathway in absence of ligand Source: Ensembl
  14. positive regulation of angiogenesis Source: Ensembl
  15. response to wounding Source: ProtInc
  16. viral process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Biological processi

Host-virus interaction

Enzyme and pathway databases

ReactomeiREACT_15344. Chemokine receptors bind chemokines.

Names & Taxonomyi

Protein namesi
Recommended name:
CX3C chemokine receptor 1
Short name:
C-X3-C CKR-1
Short name:
CX3CR1
Alternative name(s):
Beta chemokine receptor-like 1
CMK-BRL-1
Short name:
CMK-BRL1
Fractalkine receptor
G-protein coupled receptor 13
V28
Gene namesi
Name:CX3CR1
Synonyms:CMKBRL1, GPR13
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:2558. CX3CR1.

Subcellular locationi

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. neuronal cell body membrane Source: Ensembl
  3. neuron projection Source: Ensembl
  4. perinuclear region of cytoplasm Source: Ensembl
  5. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Macular degeneration, age-related, 12 (ARMD12) [MIM:613784]: A form of age-related macular degeneration, a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane.
Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti249 – 2491V → I Common polymorphism in Caucasian population; associated with a markedly reduced risk of acute coronary artery disease; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Ile-249 and Met-280 genotypes is impaired in the presence of bound CX3CR1 protein. 5 Publications
Corresponds to variant rs3732379 [ dbSNP | Ensembl ].
VAR_010043
Natural varianti280 – 2801T → M Common polymorphism in Caucasian population; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Met-280 and Ile-249 genotypes is impaired in the presence of bound CX3CR1 protein. 4 Publications
Corresponds to variant rs3732378 [ dbSNP | Ensembl ].
VAR_010044

Keywords - Diseasei

Age-related macular degeneration

Organism-specific databases

MIMi609423. phenotype.
613784. phenotype.
Orphaneti279. Age-related macular degeneration.
PharmGKBiPA27054.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 355355CX3C chemokine receptor 1PRO_0000069326Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi102 ↔ 175PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiP49238.
PRIDEiP49238.

PTM databases

PhosphoSiteiP49238.

Expressioni

Tissue specificityi

Expressed in lymphoid and neural tissues.

Gene expression databases

BgeeiP49238.
CleanExiHS_CX3CR1.
ExpressionAtlasiP49238. baseline and differential.
GenevestigatoriP49238.

Organism-specific databases

HPAiCAB032478.

Interactioni

Subunit structurei

Interacts with human respiratory syncytial virus (HRSV) protein G; this interaction modulates host immune response. Interacts with HIV-1 envelope polyprotein gp160.1 Publication

Protein-protein interaction databases

BioGridi107904. 1 interaction.
DIPiDIP-5879N.
MINTiMINT-6631119.
STRINGi9606.ENSP00000382166.

Structurei

3D structure databases

ProteinModelPortaliP49238.
SMRiP49238. Positions 32-334.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3131ExtracellularSequence AnalysisAdd
BLAST
Topological domaini60 – 6910CytoplasmicSequence Analysis
Topological domaini91 – 10313ExtracellularSequence AnalysisAdd
BLAST
Topological domaini126 – 14217CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini168 – 19528ExtracellularSequence AnalysisAdd
BLAST
Topological domaini216 – 23116CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini257 – 27317ExtracellularSequence AnalysisAdd
BLAST
Topological domaini298 – 35558CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei32 – 5928Helical; Name=1Sequence AnalysisAdd
BLAST
Transmembranei70 – 9021Helical; Name=2Sequence AnalysisAdd
BLAST
Transmembranei104 – 12522Helical; Name=3Sequence AnalysisAdd
BLAST
Transmembranei143 – 16725Helical; Name=4Sequence AnalysisAdd
BLAST
Transmembranei196 – 21520Helical; Name=5Sequence AnalysisAdd
BLAST
Transmembranei232 – 25625Helical; Name=6Sequence AnalysisAdd
BLAST
Transmembranei274 – 29724Helical; Name=7Sequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG151350.
GeneTreeiENSGT00760000118785.
HOGENOMiHOG000234122.
HOVERGENiHBG106917.
InParanoidiP49238.
KOiK04192.
OMAiAPQFMFT.
OrthoDBiEOG7327P9.
PhylomeDBiP49238.
TreeFamiTF330966.

Family and domain databases

Gene3Di1.20.1070.10. 1 hit.
InterProiIPR005387. Chemokine_CX3CR1.
IPR000355. Chemokine_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PANTHERiPTHR24227. PTHR24227. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01562. FRACTALKINER.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P49238-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDQFPESVTE NFEYDDLAEA CYIGDIVVFG TVFLSIFYSV IFAIGLVGNL
60 70 80 90 100
LVVFALTNSK KPKSVTDIYL LNLALSDLLF VATLPFWTHY LINEKGLHNA
110 120 130 140 150
MCKFTTAFFF IGFFGSIFFI TVISIDRYLA IVLAANSMNN RTVQHGVTIS
160 170 180 190 200
LGVWAAAILV AAPQFMFTKQ KENECLGDYP EVLQEIWPVL RNVETNFLGF
210 220 230 240 250
LLPLLIMSYC YFRIIQTLFS CKNHKKAKAI KLILLVVIVF FLFWTPYNVM
260 270 280 290 300
IFLETLKLYD FFPSCDMRKD LRLALSVTET VAFSHCCLNP LIYAFAGEKF
310 320 330 340 350
RRYLYHLYGK CLAVLCGRSV HVDFSSSESQ RSRHGSVLSS NFTYHTSDGD

ALLLL
Length:355
Mass (Da):40,396
Last modified:February 1, 1996 - v1
Checksum:iC59DC5F4C4312F22
GO
Isoform 2 (identifier: P49238-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MREPLEALKLADLDFRKSSLASGWRMASGAFTM

Show »
Length:387
Mass (Da):43,935
Checksum:i446834BF5BF0FC5B
GO
Isoform 3 (identifier: P49238-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASGAFTM

Show »
Length:362
Mass (Da):41,062
Checksum:i193A12DC884FC41B
GO
Isoform 4 (identifier: P49238-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MREPLEAFKLADLDFRKSSLASGWRMASGAFTM

Note: No experimental confirmation available.Curated

Show »
Length:387
Mass (Da):43,969
Checksum:iA90DFBDE74941C59
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform 4 (identifier: P49238-4)
Sequence conflicti8 – 81F → L in DA413545. (PubMed:14702039)Curated

Polymorphismi

Variations in CX3CR1 are associated with rapid progression to AIDS [MIMi:609423]. Increased susceptibility to HIV infection and rapid progression to AIDS are associated with the Ile-249/Met-280 haplotype.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti13 – 131E → D.1 Publication
Corresponds to variant rs41535248 [ dbSNP | Ensembl ].
VAR_049386
Natural varianti57 – 571T → A.1 Publication
VAR_010041
Natural varianti122 – 1221V → I.1 Publication
Corresponds to variant rs143001773 [ dbSNP | Ensembl ].
VAR_010042
Natural varianti147 – 1471V → I.
Corresponds to variant rs3732380 [ dbSNP | Ensembl ].
VAR_022062
Natural varianti249 – 2491V → I Common polymorphism in Caucasian population; associated with a markedly reduced risk of acute coronary artery disease; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Ile-249 and Met-280 genotypes is impaired in the presence of bound CX3CR1 protein. 5 Publications
Corresponds to variant rs3732379 [ dbSNP | Ensembl ].
VAR_010043
Natural varianti280 – 2801T → M Common polymorphism in Caucasian population; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Met-280 and Ile-249 genotypes is impaired in the presence of bound CX3CR1 protein. 4 Publications
Corresponds to variant rs3732378 [ dbSNP | Ensembl ].
VAR_010044

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MREPLEALKLADLDFRKSSL ASGWRMASGAFTM in isoform 2. CuratedVSP_009681
Alternative sequencei1 – 11M → MASGAFTM in isoform 3. CuratedVSP_009682
Alternative sequencei1 – 11M → MREPLEAFKLADLDFRKSSL ASGWRMASGAFTM in isoform 4. 1 PublicationVSP_044595

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U20350 mRNA. Translation: AAA91783.1.
U28934 mRNA. Translation: AAA87032.1.
AY016370 Genomic DNA. Translation: AAK08627.1.
AK312373 mRNA. Translation: BAG35291.1.
DA413545 mRNA. No translation available.
EF064744 Genomic DNA. Translation: ABK41927.1.
EU006531 Genomic DNA. Translation: ABS29268.1.
AC092053 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64576.1.
BC028078 mRNA. Translation: AAH28078.1.
CCDSiCCDS43069.1. [P49238-1]
CCDS54571.1. [P49238-4]
PIRiJC4304.
RefSeqiNP_001164642.1. NM_001171171.1. [P49238-1]
NP_001164643.1. NM_001171172.1. [P49238-1]
NP_001164645.1. NM_001171174.1. [P49238-4]
NP_001328.1. NM_001337.3. [P49238-1]
UniGeneiHs.78913.

Genome annotation databases

EnsembliENST00000358309; ENSP00000351059; ENSG00000168329. [P49238-4]
ENST00000399220; ENSP00000382166; ENSG00000168329. [P49238-1]
ENST00000541347; ENSP00000439140; ENSG00000168329. [P49238-1]
ENST00000542107; ENSP00000444928; ENSG00000168329. [P49238-1]
GeneIDi1524.
KEGGihsa:1524.
UCSCiuc003cjl.3. human. [P49238-1]

Polymorphism databases

DMDMi1351394.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U20350 mRNA. Translation: AAA91783.1 .
U28934 mRNA. Translation: AAA87032.1 .
AY016370 Genomic DNA. Translation: AAK08627.1 .
AK312373 mRNA. Translation: BAG35291.1 .
DA413545 mRNA. No translation available.
EF064744 Genomic DNA. Translation: ABK41927.1 .
EU006531 Genomic DNA. Translation: ABS29268.1 .
AC092053 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64576.1 .
BC028078 mRNA. Translation: AAH28078.1 .
CCDSi CCDS43069.1. [P49238-1 ]
CCDS54571.1. [P49238-4 ]
PIRi JC4304.
RefSeqi NP_001164642.1. NM_001171171.1. [P49238-1 ]
NP_001164643.1. NM_001171172.1. [P49238-1 ]
NP_001164645.1. NM_001171174.1. [P49238-4 ]
NP_001328.1. NM_001337.3. [P49238-1 ]
UniGenei Hs.78913.

3D structure databases

ProteinModelPortali P49238.
SMRi P49238. Positions 32-334.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107904. 1 interaction.
DIPi DIP-5879N.
MINTi MINT-6631119.
STRINGi 9606.ENSP00000382166.

Chemistry

BindingDBi P49238.
ChEMBLi CHEMBL4843.
GuidetoPHARMACOLOGYi 74.

Protein family/group databases

GPCRDBi Search...

PTM databases

PhosphoSitei P49238.

Polymorphism databases

DMDMi 1351394.

Proteomic databases

PaxDbi P49238.
PRIDEi P49238.

Protocols and materials databases

DNASUi 1524.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000358309 ; ENSP00000351059 ; ENSG00000168329 . [P49238-4 ]
ENST00000399220 ; ENSP00000382166 ; ENSG00000168329 . [P49238-1 ]
ENST00000541347 ; ENSP00000439140 ; ENSG00000168329 . [P49238-1 ]
ENST00000542107 ; ENSP00000444928 ; ENSG00000168329 . [P49238-1 ]
GeneIDi 1524.
KEGGi hsa:1524.
UCSCi uc003cjl.3. human. [P49238-1 ]

Organism-specific databases

CTDi 1524.
GeneCardsi GC03M039279.
HGNCi HGNC:2558. CX3CR1.
HPAi CAB032478.
MIMi 601470. gene.
609423. phenotype.
613784. phenotype.
neXtProti NX_P49238.
Orphaneti 279. Age-related macular degeneration.
PharmGKBi PA27054.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG151350.
GeneTreei ENSGT00760000118785.
HOGENOMi HOG000234122.
HOVERGENi HBG106917.
InParanoidi P49238.
KOi K04192.
OMAi APQFMFT.
OrthoDBi EOG7327P9.
PhylomeDBi P49238.
TreeFami TF330966.

Enzyme and pathway databases

Reactomei REACT_15344. Chemokine receptors bind chemokines.

Miscellaneous databases

GeneWikii CX3CR1.
GenomeRNAii 1524.
NextBioi 35535042.
PROi P49238.
SOURCEi Search...

Gene expression databases

Bgeei P49238.
CleanExi HS_CX3CR1.
ExpressionAtlasi P49238. baseline and differential.
Genevestigatori P49238.

Family and domain databases

Gene3Di 1.20.1070.10. 1 hit.
InterProi IPR005387. Chemokine_CX3CR1.
IPR000355. Chemokine_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view ]
PANTHERi PTHR24227. PTHR24227. 1 hit.
Pfami PF00001. 7tm_1. 1 hit.
[Graphical view ]
PRINTSi PR01562. FRACTALKINER.
PR00237. GPCRRHODOPSN.
PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The orphan G-protein-coupled receptor-encoding gene V28 is closely related to genes for chemokine receptors and is expressed in lymphoid and neural tissues."
    Raport C.J., Schweickart V.L., Eddy R.L. Jr., Shows T.B., Gray P.W.
    Gene 163:295-299(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Cloning, chromosomal localization, and RNA expression of a human beta chemokine receptor-like gene."
    Combadiere C., Ahuja S.K., Murphy P.M.
    DNA Cell Biol. 14:673-680(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Genomic organization and evolution of the CX3CR1/CCR8 chemokine receptor locus."
    DeVries M.E., Cao H., Wang J., Xu L., Kelvin A.A., Ran L., Chau L.A., Madrenas J., Hegele R.A., Kelvin D.J.
    J. Biol. Chem. 278:11985-11994(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-185 (ISOFORM 4), VARIANTS ILE-249 AND MET-280.
    Tissue: Amygdala and Thalamus.
  5. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  6. NIEHS SNPs program
    Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ASP-13; ILE-249 AND MET-280.
  7. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Blood.
  10. "CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein."
    Tripp R.A., Jones L.P., Haynes L.M., Zheng H., Murphy P.M., Anderson L.J.
    Nat. Immunol. 2:732-738(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HRSV PROTEIN G.
  11. "Two novel fully functional isoforms of CX3CR1 are potent HIV coreceptors."
    Garin A., Tarantino N., Faure S., Daoudi M., Lecureuil C., Bourdais A., Debre P., Deterre P., Combadiere C.
    J. Immunol. 171:5305-5312(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING, CHARACTERIZATION (ISOFORMS 2 AND 3).
  12. "Identification and molecular characterization of fractalkine receptor CX3CR1, which mediates both leukocyte migration and adhesion."
    Imai T., Hieshima K., Haskell C., Baba M., Nagira M., Nishimura M., Kakizaki M., Takagi S., Nomiyama H., Schall T.J., Yoshie O.
    Cell 91:521-530(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  13. "Identification of CX3CR1. A chemotactic receptor for the human CX3C chemokine fractalkine and a fusion coreceptor for HIV-1."
    Combadiere C., Salzwedel K., Smith E.D., Tiffany H.L., Berger E.A., Murphy P.M.
    J. Biol. Chem. 273:23799-23804(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  14. "Rapid progression to AIDS in HIV+ individuals with a structural variant of the chemokine receptor CX3CR1."
    Faure S., Meyer L., Costagliola D., Vaneensberghe C., Genin E., Autran B., Delfraissy J.-F., McDermott D.H., Murphy P.M., Debre P., Theodorou I., Combadiere C.
    Science 287:2274-2277(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS ALA-57; ILE-122; ILE-249 AND MET-280.
  15. "Polymorphism in the fractalkine receptor CX3CR1 as a genetic risk factor for coronary artery disease."
    Moatti D., Faure S., Fumeron F., Amara M.E.-W., Seknadji P., McDermott D.H., Debre P., Aumont M.C., Murphy P.M., de Prost D., Combadiere C.
    Blood 97:1925-1928(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ILE-249.
  16. "The involvement of sequence variation and expression of CX3CR1 in the pathogenesis of age-related macular degeneration."
    Tuo J., Smith B.C., Bojanowski C.M., Meleth A.D., Gery I., Csaky K.G., Chew E.Y., Chan C.C.
    FASEB J. 18:1297-1299(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS ILE-249 AND MET-280, ASSOCIATION WITH ARMD12.
  17. "CX3CR1-dependent subretinal microglia cell accumulation is associated with cardinal features of age-related macular degeneration."
    Combadiere C., Feumi C., Raoul W., Keller N., Rodero M., Pezard A., Lavalette S., Houssier M., Jonet L., Picard E., Debre P., Sirinyan M., Deterre P., Ferroukhi T., Cohen S.Y., Chauvaud D., Jeanny J.C., Chemtob S., Behar-Cohen F., Sennlaub F.
    J. Clin. Invest. 117:2920-2928(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION OF VARIANTS ILE-249 AND MET-280, EFFECT ON CHEMOTAXIS OF MONOCYTES OF ARMD12 PATIENTS.

Entry informationi

Entry nameiCX3C1_HUMAN
AccessioniPrimary (citable) accession number: P49238
Secondary accession number(s): A0N0N6, B2R5Z4, J3KP17
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: October 29, 2014
This is version 143 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3