Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P49238

- CX3C1_HUMAN

UniProt

P49238 - CX3C1_HUMAN

Protein

CX3C chemokine receptor 1

Gene

CX3CR1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 142 (01 Oct 2014)
      Sequence version 1 (01 Feb 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for the CX3C chemokine fractalkine and mediates both its adhesive and migratory functions. Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro). Isoform 2 and isoform 3 seem to be more potent HIV-1 coreceptors than isoform 1.

    GO - Molecular functioni

    1. chemokine receptor activity Source: ProtInc
    2. C-X3-C chemokine receptor activity Source: Ensembl
    3. protein binding Source: UniProtKB

    GO - Biological processi

    1. cell adhesion Source: ProtInc
    2. cellular defense response Source: ProtInc
    3. cellular response to lipopolysaccharide Source: Ensembl
    4. cellular response to transforming growth factor beta stimulus Source: Ensembl
    5. cerebral cortex cell migration Source: Ensembl
    6. chemokine-mediated signaling pathway Source: GOC
    7. chemotaxis Source: ProtInc
    8. G-protein coupled receptor signaling pathway Source: ProtInc
    9. macrophage chemotaxis Source: Ensembl
    10. microglial cell activation involved in immune response Source: Ensembl
    11. negative regulation of angiogenesis Source: Ensembl
    12. negative regulation of cell migration Source: Ensembl
    13. negative regulation of extrinsic apoptotic signaling pathway in absence of ligand Source: Ensembl
    14. positive regulation of angiogenesis Source: Ensembl
    15. response to wounding Source: ProtInc
    16. viral process Source: UniProtKB-KW

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Keywords - Biological processi

    Host-virus interaction

    Enzyme and pathway databases

    ReactomeiREACT_15344. Chemokine receptors bind chemokines.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    CX3C chemokine receptor 1
    Short name:
    C-X3-C CKR-1
    Short name:
    CX3CR1
    Alternative name(s):
    Beta chemokine receptor-like 1
    CMK-BRL-1
    Short name:
    CMK-BRL1
    Fractalkine receptor
    G-protein coupled receptor 13
    V28
    Gene namesi
    Name:CX3CR1
    Synonyms:CMKBRL1, GPR13
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:2558. CX3CR1.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. neuronal cell body membrane Source: Ensembl
    3. neuron projection Source: Ensembl
    4. perinuclear region of cytoplasm Source: Ensembl
    5. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Macular degeneration, age-related, 12 (ARMD12) [MIM:613784]: A form of age-related macular degeneration, a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane.
    Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti249 – 2491V → I Common polymorphism in Caucasian population; associated with a markedly reduced risk of acute coronary artery disease; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Ile-249 and Met-280 genotypes is impaired in the presence of bound CX3CR1 protein. 5 Publications
    Corresponds to variant rs3732379 [ dbSNP | Ensembl ].
    VAR_010043
    Natural varianti280 – 2801T → M Common polymorphism in Caucasian population; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Met-280 and Ile-249 genotypes is impaired in the presence of bound CX3CR1 protein. 4 Publications
    Corresponds to variant rs3732378 [ dbSNP | Ensembl ].
    VAR_010044

    Keywords - Diseasei

    Age-related macular degeneration

    Organism-specific databases

    MIMi609423. phenotype.
    613784. phenotype.
    Orphaneti279. Age-related macular degeneration.
    PharmGKBiPA27054.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 355355CX3C chemokine receptor 1PRO_0000069326Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi102 ↔ 175PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDbiP49238.
    PRIDEiP49238.

    PTM databases

    PhosphoSiteiP49238.

    Expressioni

    Tissue specificityi

    Expressed in lymphoid and neural tissues.

    Gene expression databases

    ArrayExpressiP49238.
    BgeeiP49238.
    CleanExiHS_CX3CR1.
    GenevestigatoriP49238.

    Organism-specific databases

    HPAiCAB032478.

    Interactioni

    Subunit structurei

    Interacts with human respiratory syncytial virus (HRSV) protein G; this interaction modulates host immune response. Interacts with HIV-1 envelope polyprotein gp160.1 Publication

    Protein-protein interaction databases

    BioGridi107904. 1 interaction.
    DIPiDIP-5879N.
    MINTiMINT-6631119.
    STRINGi9606.ENSP00000382166.

    Structurei

    3D structure databases

    ProteinModelPortaliP49238.
    SMRiP49238. Positions 33-304.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3131ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini60 – 6910CytoplasmicSequence Analysis
    Topological domaini91 – 10313ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini126 – 14217CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini168 – 19528ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini216 – 23116CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini257 – 27317ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini298 – 35558CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei32 – 5928Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei70 – 9021Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei104 – 12522Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei143 – 16725Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei196 – 21520Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei232 – 25625Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei274 – 29724Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG151350.
    HOGENOMiHOG000234122.
    HOVERGENiHBG106917.
    InParanoidiP49238.
    KOiK04192.
    OMAiAPQFMFT.
    OrthoDBiEOG7327P9.
    PhylomeDBiP49238.
    TreeFamiTF330966.

    Family and domain databases

    Gene3Di1.20.1070.10. 1 hit.
    InterProiIPR005387. Chemokine_CX3CR1.
    IPR000355. Chemokine_rcpt.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    [Graphical view]
    PANTHERiPTHR24227. PTHR24227. 1 hit.
    PfamiPF00001. 7tm_1. 1 hit.
    [Graphical view]
    PRINTSiPR01562. FRACTALKINER.
    PR00237. GPCRRHODOPSN.
    PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P49238-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDQFPESVTE NFEYDDLAEA CYIGDIVVFG TVFLSIFYSV IFAIGLVGNL    50
    LVVFALTNSK KPKSVTDIYL LNLALSDLLF VATLPFWTHY LINEKGLHNA 100
    MCKFTTAFFF IGFFGSIFFI TVISIDRYLA IVLAANSMNN RTVQHGVTIS 150
    LGVWAAAILV AAPQFMFTKQ KENECLGDYP EVLQEIWPVL RNVETNFLGF 200
    LLPLLIMSYC YFRIIQTLFS CKNHKKAKAI KLILLVVIVF FLFWTPYNVM 250
    IFLETLKLYD FFPSCDMRKD LRLALSVTET VAFSHCCLNP LIYAFAGEKF 300
    RRYLYHLYGK CLAVLCGRSV HVDFSSSESQ RSRHGSVLSS NFTYHTSDGD 350
    ALLLL 355
    Length:355
    Mass (Da):40,396
    Last modified:February 1, 1996 - v1
    Checksum:iC59DC5F4C4312F22
    GO
    Isoform 2 (identifier: P49238-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MREPLEALKLADLDFRKSSLASGWRMASGAFTM

    Show »
    Length:387
    Mass (Da):43,935
    Checksum:i446834BF5BF0FC5B
    GO
    Isoform 3 (identifier: P49238-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MASGAFTM

    Show »
    Length:362
    Mass (Da):41,062
    Checksum:i193A12DC884FC41B
    GO
    Isoform 4 (identifier: P49238-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MREPLEAFKLADLDFRKSSLASGWRMASGAFTM

    Note: No experimental confirmation available.Curated

    Show »
    Length:387
    Mass (Da):43,969
    Checksum:iA90DFBDE74941C59
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Isoform 4 (identifier: P49238-4)
    Sequence conflicti8 – 81F → L in DA413545. (PubMed:14702039)Curated

    Polymorphismi

    Variations in CX3CR1 are associated with rapid progression to AIDS [MIMi:609423]. Increased susceptibility to HIV infection and rapid progression to AIDS are associated with the Ile-249/Met-280 haplotype.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti13 – 131E → D.1 Publication
    Corresponds to variant rs41535248 [ dbSNP | Ensembl ].
    VAR_049386
    Natural varianti57 – 571T → A.1 Publication
    VAR_010041
    Natural varianti122 – 1221V → I.1 Publication
    Corresponds to variant rs143001773 [ dbSNP | Ensembl ].
    VAR_010042
    Natural varianti147 – 1471V → I.
    Corresponds to variant rs3732380 [ dbSNP | Ensembl ].
    VAR_022062
    Natural varianti249 – 2491V → I Common polymorphism in Caucasian population; associated with a markedly reduced risk of acute coronary artery disease; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Ile-249 and Met-280 genotypes is impaired in the presence of bound CX3CR1 protein. 5 Publications
    Corresponds to variant rs3732379 [ dbSNP | Ensembl ].
    VAR_010043
    Natural varianti280 – 2801T → M Common polymorphism in Caucasian population; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Met-280 and Ile-249 genotypes is impaired in the presence of bound CX3CR1 protein. 4 Publications
    Corresponds to variant rs3732378 [ dbSNP | Ensembl ].
    VAR_010044

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MREPLEALKLADLDFRKSSL ASGWRMASGAFTM in isoform 2. CuratedVSP_009681
    Alternative sequencei1 – 11M → MASGAFTM in isoform 3. CuratedVSP_009682
    Alternative sequencei1 – 11M → MREPLEAFKLADLDFRKSSL ASGWRMASGAFTM in isoform 4. 1 PublicationVSP_044595

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U20350 mRNA. Translation: AAA91783.1.
    U28934 mRNA. Translation: AAA87032.1.
    AY016370 Genomic DNA. Translation: AAK08627.1.
    AK312373 mRNA. Translation: BAG35291.1.
    DA413545 mRNA. No translation available.
    EF064744 Genomic DNA. Translation: ABK41927.1.
    EU006531 Genomic DNA. Translation: ABS29268.1.
    AC092053 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64576.1.
    BC028078 mRNA. Translation: AAH28078.1.
    CCDSiCCDS43069.1. [P49238-1]
    CCDS54571.1. [P49238-4]
    PIRiJC4304.
    RefSeqiNP_001164642.1. NM_001171171.1. [P49238-1]
    NP_001164643.1. NM_001171172.1. [P49238-1]
    NP_001164645.1. NM_001171174.1. [P49238-4]
    NP_001328.1. NM_001337.3. [P49238-1]
    UniGeneiHs.78913.

    Genome annotation databases

    EnsembliENST00000358309; ENSP00000351059; ENSG00000168329. [P49238-4]
    ENST00000399220; ENSP00000382166; ENSG00000168329. [P49238-1]
    ENST00000541347; ENSP00000439140; ENSG00000168329. [P49238-1]
    ENST00000542107; ENSP00000444928; ENSG00000168329. [P49238-1]
    GeneIDi1524.
    KEGGihsa:1524.
    UCSCiuc003cjl.3. human. [P49238-1]

    Polymorphism databases

    DMDMi1351394.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    NIEHS-SNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U20350 mRNA. Translation: AAA91783.1 .
    U28934 mRNA. Translation: AAA87032.1 .
    AY016370 Genomic DNA. Translation: AAK08627.1 .
    AK312373 mRNA. Translation: BAG35291.1 .
    DA413545 mRNA. No translation available.
    EF064744 Genomic DNA. Translation: ABK41927.1 .
    EU006531 Genomic DNA. Translation: ABS29268.1 .
    AC092053 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64576.1 .
    BC028078 mRNA. Translation: AAH28078.1 .
    CCDSi CCDS43069.1. [P49238-1 ]
    CCDS54571.1. [P49238-4 ]
    PIRi JC4304.
    RefSeqi NP_001164642.1. NM_001171171.1. [P49238-1 ]
    NP_001164643.1. NM_001171172.1. [P49238-1 ]
    NP_001164645.1. NM_001171174.1. [P49238-4 ]
    NP_001328.1. NM_001337.3. [P49238-1 ]
    UniGenei Hs.78913.

    3D structure databases

    ProteinModelPortali P49238.
    SMRi P49238. Positions 33-304.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107904. 1 interaction.
    DIPi DIP-5879N.
    MINTi MINT-6631119.
    STRINGi 9606.ENSP00000382166.

    Chemistry

    BindingDBi P49238.
    ChEMBLi CHEMBL4843.
    GuidetoPHARMACOLOGYi 74.

    Protein family/group databases

    GPCRDBi Search...

    PTM databases

    PhosphoSitei P49238.

    Polymorphism databases

    DMDMi 1351394.

    Proteomic databases

    PaxDbi P49238.
    PRIDEi P49238.

    Protocols and materials databases

    DNASUi 1524.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000358309 ; ENSP00000351059 ; ENSG00000168329 . [P49238-4 ]
    ENST00000399220 ; ENSP00000382166 ; ENSG00000168329 . [P49238-1 ]
    ENST00000541347 ; ENSP00000439140 ; ENSG00000168329 . [P49238-1 ]
    ENST00000542107 ; ENSP00000444928 ; ENSG00000168329 . [P49238-1 ]
    GeneIDi 1524.
    KEGGi hsa:1524.
    UCSCi uc003cjl.3. human. [P49238-1 ]

    Organism-specific databases

    CTDi 1524.
    GeneCardsi GC03M039279.
    HGNCi HGNC:2558. CX3CR1.
    HPAi CAB032478.
    MIMi 601470. gene.
    609423. phenotype.
    613784. phenotype.
    neXtProti NX_P49238.
    Orphaneti 279. Age-related macular degeneration.
    PharmGKBi PA27054.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG151350.
    HOGENOMi HOG000234122.
    HOVERGENi HBG106917.
    InParanoidi P49238.
    KOi K04192.
    OMAi APQFMFT.
    OrthoDBi EOG7327P9.
    PhylomeDBi P49238.
    TreeFami TF330966.

    Enzyme and pathway databases

    Reactomei REACT_15344. Chemokine receptors bind chemokines.

    Miscellaneous databases

    GeneWikii CX3CR1.
    GenomeRNAii 1524.
    NextBioi 35535042.
    PROi P49238.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P49238.
    Bgeei P49238.
    CleanExi HS_CX3CR1.
    Genevestigatori P49238.

    Family and domain databases

    Gene3Di 1.20.1070.10. 1 hit.
    InterProi IPR005387. Chemokine_CX3CR1.
    IPR000355. Chemokine_rcpt.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    [Graphical view ]
    PANTHERi PTHR24227. PTHR24227. 1 hit.
    Pfami PF00001. 7tm_1. 1 hit.
    [Graphical view ]
    PRINTSi PR01562. FRACTALKINER.
    PR00237. GPCRRHODOPSN.
    PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The orphan G-protein-coupled receptor-encoding gene V28 is closely related to genes for chemokine receptors and is expressed in lymphoid and neural tissues."
      Raport C.J., Schweickart V.L., Eddy R.L. Jr., Shows T.B., Gray P.W.
      Gene 163:295-299(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Cloning, chromosomal localization, and RNA expression of a human beta chemokine receptor-like gene."
      Combadiere C., Ahuja S.K., Murphy P.M.
      DNA Cell Biol. 14:673-680(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Genomic organization and evolution of the CX3CR1/CCR8 chemokine receptor locus."
      DeVries M.E., Cao H., Wang J., Xu L., Kelvin A.A., Ran L., Chau L.A., Madrenas J., Hegele R.A., Kelvin D.J.
      J. Biol. Chem. 278:11985-11994(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-185 (ISOFORM 4), VARIANTS ILE-249 AND MET-280.
      Tissue: Amygdala and Thalamus.
    5. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    6. NIEHS SNPs program
      Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ASP-13; ILE-249 AND MET-280.
    7. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Blood.
    10. "CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein."
      Tripp R.A., Jones L.P., Haynes L.M., Zheng H., Murphy P.M., Anderson L.J.
      Nat. Immunol. 2:732-738(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH HRSV PROTEIN G.
    11. "Two novel fully functional isoforms of CX3CR1 are potent HIV coreceptors."
      Garin A., Tarantino N., Faure S., Daoudi M., Lecureuil C., Bourdais A., Debre P., Deterre P., Combadiere C.
      J. Immunol. 171:5305-5312(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING, CHARACTERIZATION (ISOFORMS 2 AND 3).
    12. "Identification and molecular characterization of fractalkine receptor CX3CR1, which mediates both leukocyte migration and adhesion."
      Imai T., Hieshima K., Haskell C., Baba M., Nagira M., Nishimura M., Kakizaki M., Takagi S., Nomiyama H., Schall T.J., Yoshie O.
      Cell 91:521-530(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    13. "Identification of CX3CR1. A chemotactic receptor for the human CX3C chemokine fractalkine and a fusion coreceptor for HIV-1."
      Combadiere C., Salzwedel K., Smith E.D., Tiffany H.L., Berger E.A., Murphy P.M.
      J. Biol. Chem. 273:23799-23804(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    14. "Rapid progression to AIDS in HIV+ individuals with a structural variant of the chemokine receptor CX3CR1."
      Faure S., Meyer L., Costagliola D., Vaneensberghe C., Genin E., Autran B., Delfraissy J.-F., McDermott D.H., Murphy P.M., Debre P., Theodorou I., Combadiere C.
      Science 287:2274-2277(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS ALA-57; ILE-122; ILE-249 AND MET-280.
    15. "Polymorphism in the fractalkine receptor CX3CR1 as a genetic risk factor for coronary artery disease."
      Moatti D., Faure S., Fumeron F., Amara M.E.-W., Seknadji P., McDermott D.H., Debre P., Aumont M.C., Murphy P.M., de Prost D., Combadiere C.
      Blood 97:1925-1928(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT ILE-249.
    16. "The involvement of sequence variation and expression of CX3CR1 in the pathogenesis of age-related macular degeneration."
      Tuo J., Smith B.C., Bojanowski C.M., Meleth A.D., Gery I., Csaky K.G., Chew E.Y., Chan C.C.
      FASEB J. 18:1297-1299(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS ILE-249 AND MET-280, ASSOCIATION WITH ARMD12.
    17. "CX3CR1-dependent subretinal microglia cell accumulation is associated with cardinal features of age-related macular degeneration."
      Combadiere C., Feumi C., Raoul W., Keller N., Rodero M., Pezard A., Lavalette S., Houssier M., Jonet L., Picard E., Debre P., Sirinyan M., Deterre P., Ferroukhi T., Cohen S.Y., Chauvaud D., Jeanny J.C., Chemtob S., Behar-Cohen F., Sennlaub F.
      J. Clin. Invest. 117:2920-2928(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION OF VARIANTS ILE-249 AND MET-280, EFFECT ON CHEMOTAXIS OF MONOCYTES OF ARMD12 PATIENTS.

    Entry informationi

    Entry nameiCX3C1_HUMAN
    AccessioniPrimary (citable) accession number: P49238
    Secondary accession number(s): A0N0N6, B2R5Z4, J3KP17
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1996
    Last sequence update: February 1, 1996
    Last modified: October 1, 2014
    This is version 142 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3