Reviewed,
UniProtKB/Swiss-Prot P49238 (CX3C1_HUMAN)
Last modified
November 25, 2008.
Version 76.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: CX3C chemokine receptor 1 Short name=C-X3-C CKR-1 Short name=CX3CR1 Alternative name(s): Fractalkine receptor G-protein coupled receptor 13 V28 Beta chemokine receptor-like 1 CMK-BRL-1 CMKBLR1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 355 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Receptor for the CX3C chemokine fractalkine and mediates both its adhesive and migratory functions. Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro). Isoform 2 and isoform 3 seem to be more potent HIV coreceptors than isoform 1. |
| Subcellular location | |
| Tissue specificity | Expressed in lymphoid and neural tissues. |
| Polymorphism | Variations in CX3CR1 are associated with rapid progression to AIDS [MIM:609423]. Increased susceptibility to HIV infection and rapid progression to AIDS are associated with the Ile-249/Met-280 haplotype. |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane |
| Molecular function | G-protein coupled receptor Receptor Transducer |
Gene Ontology (GO) | |
| Biological process | G-protein coupled receptor protein signaling pathway Traceable author statement. Source: ProtInc cell adhesionTraceable author statement. Source: ProtInc cellular defense responseTraceable author statement. Source: ProtInc chemotaxisTraceable author statement. Source: ProtInc response to woundingTraceable author statement. Source: ProtInc |
| Cellular component | integral to plasma membrane Ref.6 Traceable author statement. Source: ProtInc |
| Molecular function | C-X-C chemokine receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P49238-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P49238-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MREPLEALKLADLDFRKSSLASGWRMASGAFT | ||||||
| Isoform 3 (identifier: P49238-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MASGAFT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 355 | 355 | CX3C chemokine receptor 1 | PRO_0000069326 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 31 | 31 | Extracellular Potential | ||||||||
| Transmembrane | 32 – 59 | 28 | 1 Potential | ||||||||
| Topological domain | 60 – 69 | 10 | Cytoplasmic Potential | ||||||||
| Transmembrane | 70 – 90 | 21 | 2 Potential | ||||||||
| Topological domain | 91 – 103 | 13 | Extracellular Potential | ||||||||
| Transmembrane | 104 – 125 | 22 | 3 Potential | ||||||||
| Topological domain | 126 – 142 | 17 | Cytoplasmic Potential | ||||||||
| Transmembrane | 143 – 167 | 25 | 4 Potential | ||||||||
| Topological domain | 168 – 195 | 28 | Extracellular Potential | ||||||||
| Transmembrane | 196 – 215 | 20 | 5 Potential | ||||||||
| Topological domain | 216 – 231 | 16 | Cytoplasmic Potential | ||||||||
| Transmembrane | 232 – 256 | 25 | 6 Potential | ||||||||
| Topological domain | 257 – 273 | 17 | Extracellular Potential | ||||||||
| Transmembrane | 274 – 297 | 24 | 7 Potential | ||||||||
| Topological domain | 298 – 355 | 58 | Cytoplasmic Potential | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 102 ↔ 175 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 | 1 | M → MREPLEALKLADLDFRKSSL ASGWRMASGAFT in isoform 2. | VSP_009681 | |||||||
| Alternative sequence | 1 | 1 | M → MASGAFT in isoform 3. | VSP_009682 | |||||||
| Natural variant | 57 | 1 | T → A | VAR_010041 | |||||||
| Natural variant | 122 | 1 | V → I | VAR_010042 | |||||||
| Natural variant | 147 | 1 | V → I: dbSNP rs3732380. | VAR_022062 | |||||||
| Natural variant | 249 | 1 | V → I Common polymorphism in Caucasian population; associated with a markedly reduced risk of acute coronary artery disease. dbSNP rs3732379. | VAR_010043 | |||||||
| Natural variant | 280 | 1 | T → M Common polymorphism in Caucasian population. dbSNP rs3732378. | VAR_010044 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The orphan G-protein-coupled receptor-encoding gene V28 is closely related to genes for chemokine receptors and is expressed in lymphoid and neural tissues." Raport C.J., Schweickart V.L., Eddy R.L. Jr., Shows T.B., Gray P.W. Gene 163:295-299(1995) [PubMed: 7590284] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Cloning, chromosomal localization, and RNA expression of a human beta chemokine receptor-like gene." Combadiere C., Ahuja S.K., Murphy P.M. DNA Cell Biol. 14:673-680(1995) [PubMed: 7646814] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Genomic organization and evolution of the CX3CR1/CCR8 chemokine receptor locus." DeVries M.E., Cao H., Wang J., Xu L., Kelvin A.A., Ran L., Chau L.A., Madrenas J., Hegele R.A., Kelvin D.J. J. Biol. Chem. 278:11985-11994(2003) [PubMed: 12551893] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Blood. |
| [5] | "Two novel fully functional isoforms of CX3CR1 are potent HIV coreceptors." Garin A., Tarantino N., Faure S., Daoudi M., Lecureuil C., Bourdais A., Debre P., Deterre P., Combadiere C. J. Immunol. 171:5305-5312(2003) [PubMed: 14607932] [Abstract] Cited for: ALTERNATIVE SPLICING, CHARACTERIZATION OF ISOFORMS 2 AND 3. |
| [6] | "Identification and molecular characterization of fractalkine receptor CX3CR1, which mediates both leukocyte migration and adhesion." Imai T., Hieshima K., Haskell C., Baba M., Nagira M., Nishimura M., Kakizaki M., Takagi S., Nomiyama H., Schall T.J., Yoshie O. Cell 91:521-530(1997) [PubMed: 9390561] [Abstract] Cited for: CHARACTERIZATION. |
| [7] | "Identification of CX3CR1. A chemotactic receptor for the human CX3C chemokine fractalkine and a fusion coreceptor for HIV-1." Combadiere C., Salzwedel K., Smith E.D., Tiffany H.L., Berger E.A., Murphy P.M. J. Biol. Chem. 273:23799-23804(1998) [PubMed: 9726990] [Abstract] Cited for: CHARACTERIZATION. |
| [8] | "Rapid progression to AIDS in HIV+ individuals with a structural variant of the chemokine receptor CX3CR1." Faure S., Meyer L., Costagliola D., Vaneensberghe C., Genin E., Autran B., Delfraissy J.-F., McDermott D.H., Murphy P.M., Debre P., Theodorou I., Combadiere C. Science 287:2274-2277(2000) [PubMed: 10731151] [Abstract] Cited for: VARIANTS ALA-57; ILE-122; ILE-249 AND MET-280. |
| [9] | "Polymorphism in the fractalkine receptor CX3CR1 as a genetic risk factor for coronary artery disease." Moatti D., Faure S., Fumeron F., Amara M.E.-W., Seknadji P., McDermott D.H., Debre P., Aumont M.C., Murphy P.M., de Prost D., Combadiere C. Blood 97:1925-1928(2001) [PubMed: 11264153] [Abstract] Cited for: VARIANT ILE-249. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U20350 mRNA. Translation: AAA91783.1. U28934 mRNA. Translation: AAA87032.1. AY016370 Genomic DNA. Translation: AAK08627.1. BC028078 mRNA. Translation: AAH28078.1. | |
| PIR | JC4304. |
| RefSeq | NP_001328.1. |
| UniGene | Hs.78913 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP:5879N. |
Protein family/group databases | |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | P49238. |
Genome annotation databases | |
| Ensembl | ENSG00000168329. Homo sapiens. [Contig view] |
| GeneID | 1524. |
| KEGG | hsa:1524. |
Organism-specific databases | |
| H-InvDB | HIX0003188. |
| HGNC | HGNC:2558. CX3CR1. |
| MIM | 601470. gene. 609423. phenotype. |
| PharmGKB | PA27054. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOGENOM | P49238. |
| HOVERGEN | P49238. |
Gene expression databases | |
| ArrayExpress | P49238. |
| CleanEx | HS_CX3CR1. |
| GermOnline | ENSG00000168329. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005387. CX3C_fract_rcpt. IPR001277. CXC_4_rcpt. IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_supfam. [Graphical view] |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR00645. CXCCHMKINER4. PR01562. FRACTALKINER. PR00237. GPCRRHODOPSN. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 6311. |
| SOURCE | Search... |
Entry information
| Entry name | CX3C1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P49238 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


