Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P49238 (CX3C1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 137. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
CX3C chemokine receptor 1

Short name=C-X3-C CKR-1
Short name=CX3CR1
Alternative name(s):
Beta chemokine receptor-like 1
CMK-BRL-1
Short name=CMK-BRL1
Fractalkine receptor
G-protein coupled receptor 13
V28
Gene names
Name:CX3CR1
Synonyms:CMKBRL1, GPR13
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length355 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for the CX3C chemokine fractalkine and mediates both its adhesive and migratory functions. Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro). Isoform 2 and isoform 3 seem to be more potent HIV-1 coreceptors than isoform 1.

Subunit structure

Interacts with human respiratory syncytial virus (HRSV) protein G; this interaction modulates host immune response. Interacts with HIV-1 envelope polyprotein gp160. Ref.10

Subcellular location

Cell membrane; Multi-pass membrane protein.

Tissue specificity

Expressed in lymphoid and neural tissues.

Polymorphism

Variations in CX3CR1 are associated with rapid progression to AIDS [MIM:609423]. Increased susceptibility to HIV infection and rapid progression to AIDS are associated with the Ile-249/Met-280 haplotype.

Involvement in disease

Macular degeneration, age-related, 12 (ARMD12) [MIM:613784]: A form of age-related macular degeneration, a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane.
Note: Disease susceptibility is associated with variations affecting the gene represented in this entry. Ref.16 Ref.17

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Ontologies

Keywords
   Biological processHost-virus interaction
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DiseaseAge-related macular degeneration
   DomainTransmembrane
Transmembrane helix
   Molecular functionG-protein coupled receptor
Receptor
Transducer
   PTMDisulfide bond
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processG-protein coupled receptor signaling pathway

Traceable author statement PubMed 10754298. Source: ProtInc

cell adhesion

Traceable author statement PubMed 10754298. Source: ProtInc

cellular defense response

Traceable author statement PubMed 10754298. Source: ProtInc

cellular response to lipopolysaccharide

Inferred from electronic annotation. Source: Ensembl

cellular response to transforming growth factor beta stimulus

Inferred from electronic annotation. Source: Ensembl

cerebral cortex cell migration

Inferred from electronic annotation. Source: Ensembl

chemokine-mediated signaling pathway

Traceable author statement PubMed 10754298. Source: GOC

chemotaxis

Traceable author statement PubMed 10754298. Source: ProtInc

macrophage chemotaxis

Inferred from electronic annotation. Source: Ensembl

microglial cell activation involved in immune response

Inferred from electronic annotation. Source: Ensembl

negative regulation of angiogenesis

Inferred from electronic annotation. Source: Ensembl

negative regulation of cell migration

Inferred from electronic annotation. Source: Ensembl

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

Inferred from electronic annotation. Source: Ensembl

positive regulation of angiogenesis

Inferred from electronic annotation. Source: Ensembl

response to wounding

Traceable author statement PubMed 10754298. Source: ProtInc

viral process

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of plasma membrane

Traceable author statement Ref.12. Source: ProtInc

neuron projection

Inferred from electronic annotation. Source: Ensembl

neuronal cell body membrane

Inferred from electronic annotation. Source: Ensembl

perinuclear region of cytoplasm

Inferred from electronic annotation. Source: Ensembl

plasma membrane

Traceable author statement. Source: Reactome

   Molecular_functionC-X3-C chemokine receptor activity

Inferred from electronic annotation. Source: Ensembl

chemokine receptor activity

Traceable author statement PubMed 10754298. Source: ProtInc

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P49238-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P49238-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MREPLEALKLADLDFRKSSLASGWRMASGAFTM
Isoform 3 (identifier: P49238-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASGAFTM
Isoform 4 (identifier: P49238-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MREPLEAFKLADLDFRKSSLASGWRMASGAFTM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 355355CX3C chemokine receptor 1
PRO_0000069326

Regions

Topological domain1 – 3131Extracellular Potential
Transmembrane32 – 5928Helical; Name=1; Potential
Topological domain60 – 6910Cytoplasmic Potential
Transmembrane70 – 9021Helical; Name=2; Potential
Topological domain91 – 10313Extracellular Potential
Transmembrane104 – 12522Helical; Name=3; Potential
Topological domain126 – 14217Cytoplasmic Potential
Transmembrane143 – 16725Helical; Name=4; Potential
Topological domain168 – 19528Extracellular Potential
Transmembrane196 – 21520Helical; Name=5; Potential
Topological domain216 – 23116Cytoplasmic Potential
Transmembrane232 – 25625Helical; Name=6; Potential
Topological domain257 – 27317Extracellular Potential
Transmembrane274 – 29724Helical; Name=7; Potential
Topological domain298 – 35558Cytoplasmic Potential

Amino acid modifications

Disulfide bond102 ↔ 175 By similarity

Natural variations

Alternative sequence11M → MREPLEALKLADLDFRKSSL ASGWRMASGAFTM in isoform 2.
VSP_009681
Alternative sequence11M → MASGAFTM in isoform 3.
VSP_009682
Alternative sequence11M → MREPLEAFKLADLDFRKSSL ASGWRMASGAFTM in isoform 4.
VSP_044595
Natural variant131E → D. Ref.6
Corresponds to variant rs41535248 [ dbSNP | Ensembl ].
VAR_049386
Natural variant571T → A. Ref.14
VAR_010041
Natural variant1221V → I. Ref.14
Corresponds to variant rs143001773 [ dbSNP | Ensembl ].
VAR_010042
Natural variant1471V → I.
Corresponds to variant rs3732380 [ dbSNP | Ensembl ].
VAR_022062
Natural variant2491V → I Common polymorphism in Caucasian population; associated with a markedly reduced risk of acute coronary artery disease; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Ile-249 and Met-280 genotypes is impaired in the presence of bound CX3CR1 protein. Ref.4 Ref.6 Ref.14 Ref.15 Ref.16 Ref.17
Corresponds to variant rs3732379 [ dbSNP | Ensembl ].
VAR_010043
Natural variant2801T → M Common polymorphism in Caucasian population; associated with higher risk of developing ARMD12; chemotaxis of monocytes of individuals with homozygous Met-280 and Ile-249 genotypes is impaired in the presence of bound CX3CR1 protein. Ref.4 Ref.6 Ref.14 Ref.16 Ref.17
Corresponds to variant rs3732378 [ dbSNP | Ensembl ].
VAR_010044

Experimental info

Isoform 4:
Sequence conflict81F → L in DA413545. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 1, 1996. Version 1.
Checksum: C59DC5F4C4312F22

FASTA35540,396
        10         20         30         40         50         60 
MDQFPESVTE NFEYDDLAEA CYIGDIVVFG TVFLSIFYSV IFAIGLVGNL LVVFALTNSK 

        70         80         90        100        110        120 
KPKSVTDIYL LNLALSDLLF VATLPFWTHY LINEKGLHNA MCKFTTAFFF IGFFGSIFFI 

       130        140        150        160        170        180 
TVISIDRYLA IVLAANSMNN RTVQHGVTIS LGVWAAAILV AAPQFMFTKQ KENECLGDYP 

       190        200        210        220        230        240 
EVLQEIWPVL RNVETNFLGF LLPLLIMSYC YFRIIQTLFS CKNHKKAKAI KLILLVVIVF 

       250        260        270        280        290        300 
FLFWTPYNVM IFLETLKLYD FFPSCDMRKD LRLALSVTET VAFSHCCLNP LIYAFAGEKF 

       310        320        330        340        350 
RRYLYHLYGK CLAVLCGRSV HVDFSSSESQ RSRHGSVLSS NFTYHTSDGD ALLLL 

« Hide

Isoform 2 [UniParc].

Checksum: 446834BF5BF0FC5B
Show »

FASTA38743,935
Isoform 3 [UniParc].

Checksum: 193A12DC884FC41B
Show »

FASTA36241,062
Isoform 4 [UniParc].

Checksum: A90DFBDE74941C59
Show »

FASTA38743,969

References

« Hide 'large scale' references
[1]"The orphan G-protein-coupled receptor-encoding gene V28 is closely related to genes for chemokine receptors and is expressed in lymphoid and neural tissues."
Raport C.J., Schweickart V.L., Eddy R.L. Jr., Shows T.B., Gray P.W.
Gene 163:295-299(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Cloning, chromosomal localization, and RNA expression of a human beta chemokine receptor-like gene."
Combadiere C., Ahuja S.K., Murphy P.M.
DNA Cell Biol. 14:673-680(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Genomic organization and evolution of the CX3CR1/CCR8 chemokine receptor locus."
DeVries M.E., Cao H., Wang J., Xu L., Kelvin A.A., Ran L., Chau L.A., Madrenas J., Hegele R.A., Kelvin D.J.
J. Biol. Chem. 278:11985-11994(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-185 (ISOFORM 4), VARIANTS ILE-249 AND MET-280.
Tissue: Amygdala and Thalamus.
[5]Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B., Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O., Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I., Nickerson D.A.
Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[6]NIEHS SNPs program
Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ASP-13; ILE-249 AND MET-280.
[7]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Blood.
[10]"CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein."
Tripp R.A., Jones L.P., Haynes L.M., Zheng H., Murphy P.M., Anderson L.J.
Nat. Immunol. 2:732-738(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH HRSV PROTEIN G.
[11]"Two novel fully functional isoforms of CX3CR1 are potent HIV coreceptors."
Garin A., Tarantino N., Faure S., Daoudi M., Lecureuil C., Bourdais A., Debre P., Deterre P., Combadiere C.
J. Immunol. 171:5305-5312(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING, CHARACTERIZATION (ISOFORMS 2 AND 3).
[12]"Identification and molecular characterization of fractalkine receptor CX3CR1, which mediates both leukocyte migration and adhesion."
Imai T., Hieshima K., Haskell C., Baba M., Nagira M., Nishimura M., Kakizaki M., Takagi S., Nomiyama H., Schall T.J., Yoshie O.
Cell 91:521-530(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: CHARACTERIZATION.
[13]"Identification of CX3CR1. A chemotactic receptor for the human CX3C chemokine fractalkine and a fusion coreceptor for HIV-1."
Combadiere C., Salzwedel K., Smith E.D., Tiffany H.L., Berger E.A., Murphy P.M.
J. Biol. Chem. 273:23799-23804(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: CHARACTERIZATION.
[14]"Rapid progression to AIDS in HIV+ individuals with a structural variant of the chemokine receptor CX3CR1."
Faure S., Meyer L., Costagliola D., Vaneensberghe C., Genin E., Autran B., Delfraissy J.-F., McDermott D.H., Murphy P.M., Debre P., Theodorou I., Combadiere C.
Science 287:2274-2277(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS ALA-57; ILE-122; ILE-249 AND MET-280.
[15]"Polymorphism in the fractalkine receptor CX3CR1 as a genetic risk factor for coronary artery disease."
Moatti D., Faure S., Fumeron F., Amara M.E.-W., Seknadji P., McDermott D.H., Debre P., Aumont M.C., Murphy P.M., de Prost D., Combadiere C.
Blood 97:1925-1928(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT ILE-249.
[16]"The involvement of sequence variation and expression of CX3CR1 in the pathogenesis of age-related macular degeneration."
Tuo J., Smith B.C., Bojanowski C.M., Meleth A.D., Gery I., Csaky K.G., Chew E.Y., Chan C.C.
FASEB J. 18:1297-1299(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS ILE-249 AND MET-280, ASSOCIATION WITH ARMD12.
[17]"CX3CR1-dependent subretinal microglia cell accumulation is associated with cardinal features of age-related macular degeneration."
Combadiere C., Feumi C., Raoul W., Keller N., Rodero M., Pezard A., Lavalette S., Houssier M., Jonet L., Picard E., Debre P., Sirinyan M., Deterre P., Ferroukhi T., Cohen S.Y., Chauvaud D., Jeanny J.C., Chemtob S., Behar-Cohen F., Sennlaub F.
J. Clin. Invest. 117:2920-2928(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: CHARACTERIZATION OF VARIANTS ILE-249 AND MET-280, EFFECT ON CHEMOTAXIS OF MONOCYTES OF ARMD12 PATIENTS.
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U20350 mRNA. Translation: AAA91783.1.
U28934 mRNA. Translation: AAA87032.1.
AY016370 Genomic DNA. Translation: AAK08627.1.
AK312373 mRNA. Translation: BAG35291.1.
DA413545 mRNA. No translation available.
EF064744 Genomic DNA. Translation: ABK41927.1.
EU006531 Genomic DNA. Translation: ABS29268.1.
AC092053 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64576.1.
BC028078 mRNA. Translation: AAH28078.1.
PIRJC4304.
RefSeqNP_001164642.1. NM_001171171.1.
NP_001164643.1. NM_001171172.1.
NP_001164645.1. NM_001171174.1.
NP_001328.1. NM_001337.3.
UniGeneHs.78913.

3D structure databases

ProteinModelPortalP49238.
SMRP49238. Positions 33-304.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107904. 1 interaction.
DIPDIP-5879N.
MINTMINT-6631119.
STRING9606.ENSP00000382166.

Chemistry

BindingDBP49238.
ChEMBLCHEMBL4843.
GuidetoPHARMACOLOGY74.

Protein family/group databases

GPCRDBSearch...

PTM databases

PhosphoSiteP49238.

Polymorphism databases

DMDM1351394.

Proteomic databases

PaxDbP49238.
PRIDEP49238.

Protocols and materials databases

DNASU1524.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000358309; ENSP00000351059; ENSG00000168329. [P49238-4]
ENST00000399220; ENSP00000382166; ENSG00000168329. [P49238-1]
ENST00000541347; ENSP00000439140; ENSG00000168329. [P49238-1]
ENST00000542107; ENSP00000444928; ENSG00000168329. [P49238-1]
GeneID1524.
KEGGhsa:1524.
UCSCuc003cjl.3. human. [P49238-1]

Organism-specific databases

CTD1524.
GeneCardsGC03M039279.
HGNCHGNC:2558. CX3CR1.
HPACAB032478.
MIM601470. gene.
609423. phenotype.
613784. phenotype.
neXtProtNX_P49238.
Orphanet279. Age-related macular degeneration.
PharmGKBPA27054.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG151350.
HOGENOMHOG000234122.
HOVERGENHBG106917.
InParanoidP49238.
KOK04192.
OMAAPQFMFT.
OrthoDBEOG7327P9.
PhylomeDBP49238.
TreeFamTF330966.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressP49238.
BgeeP49238.
CleanExHS_CX3CR1.
GenevestigatorP49238.

Family and domain databases

Gene3D1.20.1070.10. 1 hit.
InterProIPR005387. Chemokine_CX3CR1.
IPR000355. Chemokine_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PANTHERPTHR24227. PTHR24227. 1 hit.
PfamPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSPR01562. FRACTALKINER.
PR00237. GPCRRHODOPSN.
PROSITEPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiCX3CR1.
GenomeRNAi1524.
NextBio35535042.
PROP49238.
SOURCESearch...

Entry information

Entry nameCX3C1_HUMAN
AccessionPrimary (citable) accession number: P49238
Secondary accession number(s): A0N0N6, B2R5Z4, J3KP17
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: February 1, 1996
Last modified: April 16, 2014
This is version 137 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries