Reviewed,
UniProtKB/Swiss-Prot P49137 (MAPK2_HUMAN)
Last modified
July 7, 2009.
Version 97.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: MAP kinase-activated protein kinase 2 Short name=MAPK-activated protein kinase 2 Short name=MAPKAP kinase 2 Short name=MAPKAPK-2 Short name=MK2 EC=2.7.11.1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 400 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Its physiological substrate seems to be the small heat shock protein (HSP27/HSP25). In vitro can phosphorylate glycogen synthase at 'Ser-7' and tyrosine hydroxylase (on 'Ser-19' and 'Ser-40'). This kinase phosphorylates Ser in the peptide sequence, Hyd-X-R-X(2)-S, where Hyd is a large hydrophobic residue By similarity. Mediates both ERK and p38 MAPK/MAPK14 dependent neutrophil responses. Participates in TNF alpha-stimulated exocytosis of secretory vesicles in neutrophils. Plays a role in phagocytosis-induced respiratory burst activity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Enzyme regulation | Seems to be activated by two distinct pathways: the first involves the stimulation of p42/p44 MAPK by growth factors, the second, triggered by stress and heat shock, depends on the activation of MPK2 and upstream MAPKK/MAPKKK. |
| Subunit structure | Interacts with PHC2. Ref.5 |
| Tissue specificity | Expressed in all tissues examined. |
| Post-translational modification | Phosphorylated and activated by MAP kinase. Ref.6 |
| Sequence similarities | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | MAPKKK cascade Ref.1 Traceable author statement. Source: ProtInc Ras protein signal transductionInferred from Experiment. Source: Reactome protein amino acid phosphorylation Ref.1Traceable author statement. Source: ProtInc |
| Cellular component | cytosol Inferred from Experiment. Source: Reactome nucleus Ref.3Traceable author statement. Source: ProtInc |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW protein bindingInferred from physical interaction. Source: IntAct protein serine/threonine kinase activity Ref.3Traceable author statement. Source: ProtInc signal transducer activity Ref.1Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDC25A | P30304 | 1 | EBI-993299,EBI-747671 | |
| HSF1 | Q00613 | 4 | EBI-993299,EBI-719620 | |
| MAPK14 | Q16539 | 1 | EBI-993299,EBI-73946 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P49137-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Has a nuclear localization signal. | ||||||
| Isoform 2 (identifier: P49137-2) The sequence of this isoform differs from the canonical sequence as follows: 354-400: EEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH → GCLHDKNSDQATWLTRL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 400 | 400 | MAP kinase-activated protein kinase 2 | PRO_0000086288 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 64 – 325 | 262 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 70 – 78 | 9 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 10 – 40 | 31 | Pro-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 35 – 40 | 6 | Poly-Pro | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 186 | 1 | Proton acceptor | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 93 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 63 | 1 | Phosphotyrosine Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 328 | 1 | Phosphoserine; by autocatalysis By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 334 | 1 | Phosphothreonine; by MAPK By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 338 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 354 – 400 | 47 | EEMTS…AALAH → GCLHDKNSDQATWLTRL in isoform 2. | VSP_004910 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 173 | 1 | A → G Ref.8 | VAR_040753 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 361 | 1 | A → S Ref.8 | VAR_040754 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 116 | 1 | H → D in CAA53094. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 247 – 248 | 2 | WS → LV in CAA53094. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 59 – 61 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 69 – 74 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 84 – 86 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 91 – 96 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 99 – 101 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 102 – 109 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 120 – 127 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 133 – 138 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 143 – 145 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 146 – 150 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 160 – 179 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 189 – 191 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 192 – 200 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 203 – 205 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 237 – 258 | 22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 267 – 269 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 273 – 276 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 289 – 294 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 297 – 305 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 310 – 312 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 316 – 320 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 323 – 326 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 329 – 331 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 335 – 337 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 338 – 344 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 345 – 347 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 348 – 363 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 366 – 369 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 375 – 377 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 381 – 389 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The primary structure of a human MAP kinase activated protein kinase 2." Zu Y.-L., Wu F., Gilchrist A., Ai Y., Labadia M.E., Huang C.K. Biochem. Biophys. Res. Commun. 200:1118-1124(1994) [PubMed: 8179591] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin and Testis. |
| [3] | "The substrate specificity and structure of mitogen-activated protein (MAP) kinase-activated protein kinase-2." Stokoe D., Caudwell B., Cohen P.T.W., Cohen P. Biochem. J. 296:843-849(1993) [PubMed: 8280084] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 5-400. |
| [4] | "MAPK-activated protein kinase-2 participates in p38 MAPK-dependent and ERK-dependent functions in human neutrophils." Coxon P.Y., Rane M.J., Uriarte S., Powell D.W., Singh S., Butt W., Chen Q., McLeish K.R. Cell. Signal. 15:993-1001(2003) [PubMed: 14499342] [Abstract] Cited for: FUNCTION. |
| [5] | "P66(ShcA) interacts with MAPKAP kinase 2 and regulates its activity." Yannoni Y.M., Gaestel M., Lin L.L. FEBS Lett. 564:205-211(2004) [PubMed: 15094067] [Abstract] Cited for: INTERACTION WITH PHC2. |
| [6] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-63, MASS SPECTROMETRY. |
| [7] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [8] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLY-173 AND SER-361. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U12779 mRNA. Translation: AAA20851.1. BC036060 mRNA. Translation: AAH36060.2. BC052584 mRNA. Translation: AAH52584.1. X75346 mRNA. Translation: CAA53094.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00026054. IPI00215763. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | JC2204. S39793. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_004750.1. NP_116584.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.643566 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P49137. 7 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P49137. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P49137. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000162889. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 9261. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:9261. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001hem.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01P204924. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0023634. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:6887. MAPKAPK2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB010297. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 602006. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA30631. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | P49137. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | P49137. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | P49137. SLATPCY. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.7.11.1. 247. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | il2_1pathway. IL2-mediated signaling events. p38_mk2pathway. p38 signaling mediated by MAPKAP kinases. p38alphabetadownstreampathway. Signaling mediated by p38-alpha and p38-beta. mapktrkpathway. Trk receptor signaling mediated by the MAPK pathway. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_11061. Signalling by NGF. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P49137. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P49137. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_MAPKAPK2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000162889. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 34715. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | MAPK2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P49137 Secondary accession number(s): Q8IYD6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


