P48722 (HS74L_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Heat shock 70 kDa protein 4L Alternative name(s): Heat shock 70-related protein APG-1 Osmotic stress protein 94 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 838 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase By similarity. |
| Subunit structure | Homodimer By similarity. |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Note: May translocate to the nucleus after heat shock By similarity. |
| Tissue specificity | Highly expressed in testis. Also expressed in renal medulla of water-restricted animals. Ref.1 |
| Induction | By hyperosmolar salt stress and heat shock. Ref.2 |
| Sequence similarities | Belongs to the heat shock protein 70 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Stress response |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Chaperone |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein folding Inferred from sequence or structural similarity. Source: UniProtKB response to unfolded proteinInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from sequence or structural similarity. Source: UniProtKB nucleusInferred from sequence or structural similarity. Source: UniProtKB |
| Molecular_function | ATP binding Inferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P48722-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P48722-2) Also known as: Apg-1b; The sequence of this isoform differs from the canonical sequence as follows: 1-36: MSVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTP → MGGPPRHGVLDREER |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 838 | 838 | Heat shock 70 kDa protein 4L | PRO_0000078281 | |||||
Amino acid modifications | |||||||||
| Modified residue | 74 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 761 | 1 | Phosphothreonine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 36 | 36 | MSVVG…DRCTP → MGGPPRHGVLDREER in isoform 2. | VSP_007500 | |||||
Experimental info | |||||||||
| Sequence conflict | 175 – 176 | 2 | TA → HS in BAA08446. Ref.2 | ||||||
| Sequence conflict | 175 – 176 | 2 | TA → HS in BAA19468. Ref.3 | ||||||
| Sequence conflict | 221 | 1 | K → E in BAA08446. Ref.2 | ||||||
| Sequence conflict | 221 | 1 | K → E in BAA19468. Ref.3 | ||||||
| Sequence conflict | 279 | 1 | A → P in BAA08446. Ref.2 | ||||||
| Sequence conflict | 279 | 1 | A → P in BAA19468. Ref.3 | ||||||
| Sequence conflict | 308 | 1 | Q → R in BAA08446. Ref.2 | ||||||
| Sequence conflict | 308 | 1 | Q → R in BAA19468. Ref.3 | ||||||
| Sequence conflict | 483 | 1 | R → S in BAE37350. Ref.4 | ||||||
| Sequence conflict | 571 | 1 | T → A in BAE37350. Ref.4 | ||||||
| Sequence conflict | 776 | 1 | K → M in AAC52610. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Osmotic stress protein 94 (Osp94). A new member of the Hsp110/SSE gene subfamily." Kojima R., Randall J., Brenner B.M., Gullans S.R. J. Biol. Chem. 271:12327-12332(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "A novel hsp110-related gene, apg-1, that is abundantly expressed in the testis responds to a low temperature heat shock rather than the traditional elevated temperatures." Kaneko Y., Nishiyama H., Nonoguchi K., Higashitsuji H., Kishishita M., Fujita J. J. Biol. Chem. 272:2640-2645(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION. Strain: DDY/STD. Tissue: Testis. |
| [3] | "Apg-1b, an alternative form of apg-1 transcript." Kaneko Y., Fujita J. Submitted (MAR-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: ddY. Tissue: Testis. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Corpora quadrigemina. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N. Tissue: Brain and Salivary gland. |
| [6] | Lubec G., Klug S. Submitted (MAR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 135-153; 484-500 AND 622-632, MASS SPECTROMETRY. Tissue: Hippocampus. |
| [7] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-74, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [8] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-761, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U23921 mRNA. Translation: AAC52610.1. D49482 mRNA. Translation: BAA08446.1. AB001926 mRNA. Translation: BAA19468.1. AK033950 mRNA. Translation: BAC28524.1. AK050997 mRNA. Translation: BAC34491.1. AK144225 mRNA. Translation: BAE25783.1. AK163459 mRNA. Translation: BAE37350.1. BC012712 mRNA. Translation: AAH12712.1. BC057002 mRNA. Translation: AAH57002.1. BC110662 mRNA. Translation: AAI10663.1. |
| IPI | IPI00317710. IPI00317711. |
| RefSeq | NP_035150.3. NM_011020.3. |
| UniGene | Mm.39330. |
3D structure databases | |
| ProteinModelPortal | P48722. |
| SMR | P48722. Positions 5-700. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P48722. |
2D gel databases | |
| REPRODUCTION-2DPAGE | IPI00317710. P48722. |
Proteomic databases | |
| PaxDb | P48722. |
| PRIDE | P48722. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000077083; ENSMUSP00000076336; ENSMUSG00000025757. ENSMUST00000108086; ENSMUSP00000103721; ENSMUSG00000025757. |
| GeneID | 18415. |
| KEGG | mmu:18415. |
| UCSC | uc008pbk.1. mouse. uc008pbl.1. mouse. |
Organism-specific databases | |
| CTD | 22824. |
| MGI | MGI:107422. Hspa4l. |
Phylogenomic databases | |
| eggNOG | COG0443. |
| GeneTree | ENSGT00390000016919. |
| HOVERGEN | HBG047955. |
| InParanoid | P48722. |
| KO | K09485. |
| OMA | FITPEDM. |
| OrthoDB | EOG40K7Z4. |
Gene expression databases | |
| ArrayExpress | P48722. |
| Bgee | P48722. |
| CleanEx | MM_HSPA4L. |
| Genevestigator | P48722. |
| GermOnline | ENSMUSG00000025757. Mus musculus. |
Family and domain databases | |
| InterPro | IPR018181. Heat_shock_70_CS. IPR013126. Hsp_70_fam. [Graphical view] |
| Pfam | PF00012. HSP70. 1 hit. [Graphical view] |
| PRINTS | PR00301. HEATSHOCK70. |
| PROSITE | PS00297. HSP70_1. False negative. PS00329. HSP70_2. 1 hit. PS01036. HSP70_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | HSPA4L. mouse. |
| NextBio | 294048. |
| SOURCE | Search... |
Entry information
| Entry name | HS74L_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P48722 Secondary accession number(s): P97854 Q91X29 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
