Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Arginine kinase

Gene

Argk

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

ATP + L-arginine = ADP + N(omega)-phospho-L-arginine.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei185 – 1851ATPPROSITE-ProRule annotation
Binding sitei225 – 2251SubstrateBy similarity
Binding sitei229 – 2291ATPPROSITE-ProRule annotation
Binding sitei271 – 2711SubstrateBy similarity
Binding sitei314 – 3141SubstrateBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi122 – 1265ATPPROSITE-ProRule annotation
Nucleotide bindingi280 – 2845ATPPROSITE-ProRule annotation
Nucleotide bindingi309 – 3146ATPPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-DME-71288. Creatine metabolism.

Names & Taxonomyi

Protein namesi
Recommended name:
Arginine kinase (EC:2.7.3.3)
Short name:
AK
Gene namesi
Name:Argk
ORF Names:CG32031
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 3L

Organism-specific databases

FlyBaseiFBgn0000116. Argk.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: FlyBase
  • cytosol Source: FlyBase
  • extracellular region Source: FlyBase
  • plasma membrane Source: FlyBase
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 356356Arginine kinasePRO_0000211992Add
BLAST

Proteomic databases

PaxDbiP48610.

Expressioni

Gene expression databases

BgeeiP48610.
ExpressionAtlasiP48610. differential.
GenevisibleiP48610. DM.

Interactioni

Protein-protein interaction databases

BioGridi64445. 59 interactions.
IntActiP48610. 16 interactions.
MINTiMINT-841356.
STRINGi7227.FBpp0076270.

Structurei

3D structure databases

ProteinModelPortaliP48610.
SMRiP48610. Positions 1-356.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini6 – 9186Phosphagen kinase N-terminalPROSITE-ProRule annotationAdd
BLAST
Domaini119 – 356238Phosphagen kinase C-terminalPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni64 – 685Substrate bindingBy similarity

Sequence similaritiesi

Belongs to the ATP:guanido phosphotransferase family.PROSITE-ProRule annotation
Contains 1 phosphagen kinase C-terminal domain.PROSITE-ProRule annotation
Contains 1 phosphagen kinase N-terminal domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3581. Eukaryota.
COG3869. LUCA.
GeneTreeiENSGT00550000074561.
InParanoidiP48610.
OMAiELKGTFY.
OrthoDBiEOG7XM2XW.
PhylomeDBiP48610.

Family and domain databases

Gene3Di1.10.135.10. 1 hit.
3.30.590.10. 1 hit.
InterProiIPR000749. ATP-guanido_PTrfase.
IPR022415. ATP-guanido_PTrfase_AS.
IPR022414. ATP-guanido_PTrfase_cat.
IPR022413. ATP-guanido_PTrfase_N.
IPR014746. Gln_synth/guanido_kin_cat_dom.
[Graphical view]
PANTHERiPTHR11547. PTHR11547. 1 hit.
PfamiPF00217. ATP-gua_Ptrans. 1 hit.
PF02807. ATP-gua_PtransN. 1 hit.
[Graphical view]
SUPFAMiSSF48034. SSF48034. 1 hit.
PROSITEiPS00112. PHOSPHAGEN_KINASE. 1 hit.
PS51510. PHOSPHAGEN_KINASE_C. 1 hit.
PS51509. PHOSPHAGEN_KINASE_N. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform D (identifier: P48610-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVDAAVLAKL EEGYAKLAAS DSKSLLKKYL TKEVFDNLKN KVTPTFKSTL
60 70 80 90 100
LDVIQSGLEN HDSGVGIYAP DAEAYTVFAD LFDPIIEDYH GGFKKTDKHP
110 120 130 140 150
ASNFGDVSTF GNVDPTNEYV ISTRVRCGRS MQGYPFNPCL TEAQYKEMES
160 170 180 190 200
KVSSTLSGLE GELKGKFYPL TGMEKAVQQQ LIDDHFLFKE GDRFLQAANA
210 220 230 240 250
CRFWPSGRGI YHNDAKTFLV WCNEEDHLRI ISMQQGGDLG QIYKRLVTAV
260 270 280 290 300
NEIEKRVPFS HDDRLGFLTF CPTNLGTTIR ASVHIKVPKL ASNKAKLEEV
310 320 330 340 350
AAKYNLQVRG TRGEHTEAEG GVYDISNKRR MGLTEFEAVK EMYDGITELI

KLEKSL
Length:356
Mass (Da):39,866
Last modified:May 24, 2005 - v2
Checksum:i9AD0E80D2CE4F446
GO
Isoform A (identifier: P48610-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFALWYLTFA...QLGERKQDTM

Note: No experimental confirmation available.
Show »
Length:562
Mass (Da):61,264
Checksum:iD05E15973650E0B7
GO
Isoform B (identifier: P48610-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPIPLPKSLT...QLGERKQDTM

Note: No experimental confirmation available.
Show »
Length:432
Mass (Da):47,889
Checksum:iD3CC748B41704E59
GO
Isoform C (identifier: P48610-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGLCASKDKKEKVIEGEVANGEPNGTATAAGAGGDGKQDTM

Note: No experimental confirmation available.
Show »
Length:396
Mass (Da):43,754
Checksum:iAD60FC4C81C1E9C4
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1 – 9090Missing in AAA68173 (Ref. 1) CuratedAdd
BLAST
Sequence conflicti42 – 5110VTPTFKSTLL → GHAHLQVDPA in AAA68172 (Ref. 1) Curated
Sequence conflicti64 – 663GVG → ASA in AAA68172 (Ref. 1) Curated
Sequence conflicti85 – 851I → F in AAA68172 (Ref. 1) Curated
Sequence conflicti280 – 2801R → L in AAA68172 (Ref. 1) Curated
Sequence conflicti291 – 2911A → P in AAA68172 (Ref. 1) Curated
Sequence conflicti309 – 3135RGTRG → ANPR in AAA68172 (Ref. 1) Curated
Sequence conflicti322 – 3221V → S in AAA68172 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MFALWYLTFAVDEIRKRLAW LFSSNKPAAPALDNKPANPA PAKESAPAPAPAPTPKPAVV PPAPKPDPPKPAPAVAKPTP VPVPATAPAPPKEEPAPKPK PEPVPSPVVAPPKPTPPPAK PSSPPKQADKMPIPLPKSLT EANTNGQNGNAANGGNVDEL VFGGQQAEKVLPAAKEASND FIKGETNAFIQSIKEAQQLG ERKQDTM in isoform A. 1 PublicationVSP_013807
Alternative sequencei1 – 11M → MPIPLPKSLTEANTNGQNGN AANGGNVDELVFGGQQAEKV LPAAKEASNDFIKGETNAFI QSIKEAQQLGERKQDTM in isoform B. CuratedVSP_013808
Alternative sequencei1 – 11M → MGLCASKDKKEKVIEGEVAN GEPNGTATAAGAGGDGKQDT M in isoform C. CuratedVSP_013809

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26939 Genomic DNA. Translation: AAA68172.1.
U26940 mRNA. Translation: AAA68173.1.
AE014296 Genomic DNA. Translation: AAF50325.2.
AE014296 Genomic DNA. Translation: AAF50326.2.
AE014296 Genomic DNA. Translation: AAN11982.1.
AE014296 Genomic DNA. Translation: AAN11983.1.
AY069099 mRNA. Translation: AAL39244.1.
RefSeqiNP_001097556.2. NM_001104086.2. [P48610-1]
NP_001286989.1. NM_001300060.1. [P48610-1]
NP_523988.2. NM_079264.3. [P48610-1]
NP_729446.1. NM_168311.3. [P48610-2]
NP_729447.1. NM_168312.3. [P48610-3]
NP_729448.1. NM_168313.4. [P48610-4]
UniGeneiDm.902.

Genome annotation databases

EnsemblMetazoaiFBtr0076545; FBpp0076272; FBgn0000116. [P48610-1]
FBtr0331550; FBpp0303940; FBgn0000116. [P48610-1]
FBtr0345030; FBpp0311280; FBgn0000116. [P48610-1]
GeneIDi39041.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26939 Genomic DNA. Translation: AAA68172.1.
U26940 mRNA. Translation: AAA68173.1.
AE014296 Genomic DNA. Translation: AAF50325.2.
AE014296 Genomic DNA. Translation: AAF50326.2.
AE014296 Genomic DNA. Translation: AAN11982.1.
AE014296 Genomic DNA. Translation: AAN11983.1.
AY069099 mRNA. Translation: AAL39244.1.
RefSeqiNP_001097556.2. NM_001104086.2. [P48610-1]
NP_001286989.1. NM_001300060.1. [P48610-1]
NP_523988.2. NM_079264.3. [P48610-1]
NP_729446.1. NM_168311.3. [P48610-2]
NP_729447.1. NM_168312.3. [P48610-3]
NP_729448.1. NM_168313.4. [P48610-4]
UniGeneiDm.902.

3D structure databases

ProteinModelPortaliP48610.
SMRiP48610. Positions 1-356.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi64445. 59 interactions.
IntActiP48610. 16 interactions.
MINTiMINT-841356.
STRINGi7227.FBpp0076270.

Proteomic databases

PaxDbiP48610.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0076545; FBpp0076272; FBgn0000116. [P48610-1]
FBtr0331550; FBpp0303940; FBgn0000116. [P48610-1]
FBtr0345030; FBpp0311280; FBgn0000116. [P48610-1]
GeneIDi39041.

Organism-specific databases

CTDi39041.
FlyBaseiFBgn0000116. Argk.

Phylogenomic databases

eggNOGiKOG3581. Eukaryota.
COG3869. LUCA.
GeneTreeiENSGT00550000074561.
InParanoidiP48610.
OMAiELKGTFY.
OrthoDBiEOG7XM2XW.
PhylomeDBiP48610.

Enzyme and pathway databases

ReactomeiR-DME-71288. Creatine metabolism.

Miscellaneous databases

ChiTaRSiArgk. fly.
GenomeRNAii39041.
NextBioi811621.
PROiP48610.

Gene expression databases

BgeeiP48610.
ExpressionAtlasiP48610. differential.
GenevisibleiP48610. DM.

Family and domain databases

Gene3Di1.10.135.10. 1 hit.
3.30.590.10. 1 hit.
InterProiIPR000749. ATP-guanido_PTrfase.
IPR022415. ATP-guanido_PTrfase_AS.
IPR022414. ATP-guanido_PTrfase_cat.
IPR022413. ATP-guanido_PTrfase_N.
IPR014746. Gln_synth/guanido_kin_cat_dom.
[Graphical view]
PANTHERiPTHR11547. PTHR11547. 1 hit.
PfamiPF00217. ATP-gua_Ptrans. 1 hit.
PF02807. ATP-gua_PtransN. 1 hit.
[Graphical view]
SUPFAMiSSF48034. SSF48034. 1 hit.
PROSITEiPS00112. PHOSPHAGEN_KINASE. 1 hit.
PS51510. PHOSPHAGEN_KINASE_C. 1 hit.
PS51509. PHOSPHAGEN_KINASE_N. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Hecht L.B., Scott L.M., Collier G.E.
    Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM D).
  2. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  3. Cited for: GENOME REANNOTATION.
    Strain: Berkeley.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Strain: Berkeley.
    Tissue: Head.

Entry informationi

Entry nameiKARG_DROME
AccessioniPrimary (citable) accession number: P48610
Secondary accession number(s): Q8IQB9
, Q8IQC0, Q8T0S2, Q9VST5, Q9VST6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1996
Last sequence update: May 24, 2005
Last modified: May 11, 2016
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.